TkA03G036410 | RubberDandelionOmics

Gene overview

TkA03G036410

Reference: TK1151 Chr: Chr03 Coordinates: 9584124-9585617 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1266 bp · TkA03G036410|TK1151|cDNA

ATGCAACAAACCGCACTCTCGATTTCAACGATTCACGCTATTCTTGATTTTACGCCTAATTCTTCAAGAACCAGGTATAAATTCAATCTCAACAACGGTCAAACATGGGTGTTGTATTCGTCCTCACCGATCGATCTAACCCACGAGATATCAAAGATTTCATCTTCGCCGTTTTCGGGTGTTATTCGGATCGCGATACTCCCAAATCCAAATCTCGAAACAGTTCTCGATCTTTTCAGTTCTTGCTACCCAGTATCCGG...

CDS

Download CDS FASTA

1266 bp · TkA03G036410|TK1151|CDS

ATGCAACAAACCGCACTCTCGATTTCAACGATTCACGCTATTCTTGATTTTACGCCTAATTCTTCAAGAACCAGGTATAAATTCAATCTCAACAACGGTCAAACATGGGTGTTGTATTCGTCCTCACCGATCGATCTAACCCACGAGATATCAAAGATTTCATCTTCGCCGTTTTCGGGTGTTATTCGGATCGCGATACTCCCAAATCCAAATCTCGAAACAGTTCTCGATCTTTTCAGTTCTTGCTACCCAGTATCCGG...

Protein

Download Protein FASTA

421 aa · TkA03G036410|TK1151|PROTEIN

MQQTALSISTIHAILDFTPNSSRTRYKFNLNNGQTWVLYSSSPIDLTHEISKISSSPFSGVIRIAILPNPNLETVLDLFSSCYPVSGDAVFTTPFCVEYKWETKGWGDLLMLANPLHVRLLDGFSSKVIDEVKYNSIDGELVGVTGDSWVLKTDPVSVTWHSIKGIKEENFPEIIDSVAKDVEGLDSSRLAMIAEEIGYLEAMPKIQKYLKDSIEPWLDGTLTGNGFLYDKSWGGIITKQGSQDSSADFGFGIYNDHHYH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G036410`
TK1151 ID	TkA03G036410
OH-1004 ID	LXL04_006429
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.700
Protein coverage (%)	TK1151 100.000 / OH-1004 69.510 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G036410`
Location	Chr03:9584124-9585617 (-)
Description	Similar to ARB_01444: Probable endo-1,3(4)-beta-glucanase ARB_01444 (Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006429` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000272 polysaccharide catabolic process Biological Process GO:0006897 endocytosis Biological Process GO:0009603 detection of symbiotic fungus Biological Process GO:0030994 primary cell septum disassembly Biological Process GO:0042815 bipolar cell growth Biological Process GO:0044347 cell wall polysaccharide catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0071998 ascospore release from ascus Biological Process GO:0097248 maintenance of protein location in cell cortex of cell tip Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005938 cell cortex Cellular Component
KEGG gene cross-reference	abe:ARB_01444 spo:2541480 spo:2543379 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.350

Rank 1 · TkA03G036410 · TK1151

Cytoplasm0.249

Rank 2 · TkA03G036410 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkA03G036410 · TK1151

Lysosome / Vacuole0.164

Rank 4 · TkA03G036410 · TK1151

Cell membrane0.084

Rank 5 · TkA03G036410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03639Glyco_hydro_813-159 aa

PF17652Glyco_hydro81C197-295 aa

PF17652Glyco_hydro81C297-353 aa

PF17652Glyco_hydro81C353-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G036410	`PF03639`	Glyco_hydro_81	3	159	2.5e-32	113.1
TkA03G036410	`PF17652`	Glyco_hydro81C	197	295	1.3e-57	196.4
TkA03G036410	`PF17652`	Glyco_hydro81C	297	353	1.3e-57	196.4
TkA03G036410	`PF17652`	Glyco_hydro81C	353	416	1.3e-57	196.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card