TkA03G031940 | RubberDandelionOmics

Gene overview

TkA03G031940

Reference: TK1151 Chr: Chr03 Coordinates: 8538683-8546408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1614 bp · TkA03G031940|TK1151|cDNA

TAAAAAGGTCAGAAATTTTGTCATGTTCTCTGTTGAGGCAAAGGAAAACTGTGGAGTCTTTCCCCTGATAAACAAAAAGGCCCTGTCGCTCTCGGAGCACATATCTTTTCCGATTCGCAATAGTATAAGCGTGGATGCAAGTTTAGAGGTGCAGTTGTCGGAGATTTGCGTGATTGGCTTCCAGTACTGACTTACTATTACTCTCTCCCTCTAATGAGAAAGTGTGGAAGGAAAAAGGAGAAAATGGGAAGAGCACCATG...

CDS

Download CDS FASTA

741 bp · TkA03G031940|TK1151|CDS

ATGAGAAAGTGTGGAAGGAAAAAGGAGAAAATGGGAAGAGCACCATGCTGTAACAAAGGTGAGGTGAAGAAAGGTGCCTGGACTCCTGAAGAAGATAAGATACTTGTTGATTACATCAGTAAAAACGGCCATGGCACCTGGCGTTCTTTTCCTAGACTTGCAGGACTTCGAAGATGTGGAAAAAGTTGTCGTCTCCGGTGGACAAACTATCTTCGTCCTGATATCAAACGTGGTGCCTTCACTATTGAAGAAGAACAAAC...

Protein

Download Protein FASTA

246 aa · TkA03G031940|TK1151|PROTEIN

MRKCGRKKEKMGRAPCCNKGEVKKGAWTPEEDKILVDYISKNGHGTWRSFPRLAGLRRCGKSCRLRWTNYLRPDIKRGAFTIEEEQTIFHLHSLHGNKWAAIASQLPGRTDNEIKNFWNSHLRKRIPGLQTNLPSNSTDDKVEAKAEAKLSMDPMSVSNNFLHEWCSSDGEAFQKHMSYGIQNPIKIESDYFVTVQEGPNSTSESCDQSVKEEMTNGSESQNSYESDMTLDLLLDFPNDGEYLQYV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G031940`
TK1151 ID	TkA03G031940
OH-1004 ID	LXL04_021663
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.500
Protein coverage (%)	TK1151 100.000 / OH-1004 97.590 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G031940

Location Chr03:8538683-8546408 (-)

Description Similar to MYB17: Transcription factor MYB17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61250`	Transcription factor that may play a role in flower development by repressing ANT.	Characterization of Arabidopsis MYB transcription factor gene AtMYB17 and its possible regulation by LEAFY and AGL15.2009 · DOI: 10.1016/s1673-8527(08)60096-x LATE MERISTEM IDENTITY2 acts together with LEAFY to activate APETALA1.2011 · DOI: 10.1242/dev.063073
`At1g34670`	Transcription factor that acts as a negative regulator of lateral root (LR) development.	AtMYB93 is a novel negative regulator of lateral root development in Arabidopsis.2014 · DOI: 10.1111/nph.12879
`At3g01140`	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation.	Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.2008 · DOI: 10.1104/pp.108.126979 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0517100`	Transcriptional activator involved in cold stress response.	Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.2004 · DOI: 10.1046/j.1365-313x.2003.01938.x Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.2010 · DOI: 10.1111/j.1365-3040.2010.02221.x The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.2012 · DOI: 10.1007/s13353-011-0081-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010091 trichome branching Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0080090 regulation of primary metabolic process Biological Process

GO:0080091 regulation of raffinose metabolic process Biological Process

GO:1901957 regulation of cutin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT3G01140

ath:AT3G61250

ath:AT4G05100

ath:AT4G28110

ath:AT5G15310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA03G031940 · TK1151

Cytoplasm0.110

Rank 2 · TkA03G031940 · TK1151

Cell membrane0.022

Rank 3 · TkA03G031940 · TK1151

Mitochondrion0.013

Rank 4 · TkA03G031940 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA03G031940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding24-71 aa

PF13921Myb_DNA-bind_627-87 aa

PF08914Myb_Rap127-44 aa

PF08914Myb_Rap162-74 aa

PF00249Myb_DNA-binding77-122 aa

PF13921Myb_DNA-bind_680-125 aa

PF08914Myb_Rap180-107 aa

PF15963Myb_DNA-bind_780-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G031940	`PF00249`	Myb_DNA-binding	24	71	3.9e-35	120.4
TkA03G031940	`PF13921`	Myb_DNA-bind_6	27	87	2.4e-20	73.2
TkA03G031940	`PF08914`	Myb_Rap1	27	44	0.13	13.5
TkA03G031940	`PF08914`	Myb_Rap1	62	74	0.13	13.5
TkA03G031940	`PF00249`	Myb_DNA-binding	77	122	3.9e-35	120.4
TkA03G031940	`PF13921`	Myb_DNA-bind_6	80	125	2.4e-20	73.2
TkA03G031940	`PF08914`	Myb_Rap1	80	107	0.13	13.5
TkA03G031940	`PF15963`	Myb_DNA-bind_7	80	143	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2D9`	Arabidopsis thaliana	sp\|Q9M2D9\|MYB17_ARATH Transcription factor MYB17	55.800%	Swiss-Prot	Medium
`Q9S9Z2`	Arabidopsis thaliana	sp\|Q9S9Z2\|MYB93_ARATH Transcription factor MYB93	72.400%	Swiss-Prot	Low
`Q9LE63`	Arabidopsis thaliana	sp\|Q9LE63\|MY106_ARATH Transcription factor MYB106	70.700%	Swiss-Prot	Low
`Q9LDR8`	Arabidopsis thaliana	sp\|Q9LDR8\|MY102_ARATH Transcription factor MYB102	70.700%	Swiss-Prot	Low
`Q7XBH4`	Oryza sativa subsp. japonica	sp\|Q7XBH4\|MYB4_ORYSJ Transcription factor MYB4	70.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card