TkA03G030760 | RubberDandelionOmics

Gene overview

TkA03G030760

Reference: TK1151 Chr: Chr03 Coordinates: 8262926-8265503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2348 bp · TkA03G030760|TK1151|cDNA

ATTATATTGAAATCATTGATCCACTTCCTTTTTGATCTTCGTTTCCAAGTTCCATCTGTAACTTCCCCCTGATTTCATACACTTCGCCTTTTCTCTTCACTTTTCCACAAATTCAATCATAACCCTCTCCTAAACAAAGTCAAAATTACCTCACTAGTCAAATATGGATCTTGTTTGATTCTTTTTTCTCCTCTCAATCACCTTTTTCCGGCGATTATGGCCTCCGATATGCCAGAAACTTCCAAACGGCAAGCATGGTT...

CDS

Download CDS FASTA

1014 bp · TkA03G030760|TK1151|CDS

ATGGCCTCCGATATGCCAGAAACTTCCAAACGGCAAGCATGGTTTTGTACCACCGGACTACCAAGCGACGTTGTGGTTGATGTCGGCGACGTGACCTTCCATCTCCATAAGTTTCCTCTTATGGCTAAGAGCAAAAAGCTAAACGAGATGATGGCAGAACAAGAGACAAATGTTACAGTTAAAGCTACTGACGGGAGGGAATCTGAAGAAGATGAGCACGAAGAGATACAGGAAGAGAAAATGGCGGATACGGCGGTTGA...

Protein

Download Protein FASTA

337 aa · TkA03G030760|TK1151|PROTEIN

MASDMPETSKRQAWFCTTGLPSDVVVDVGDVTFHLHKFPLMAKSKKLNEMMAEQETNVTVKATDGRESEEDEHEEIQEEKMADTAVEEHCHIMLPDFPGGSETFETAAKFCYAVKIELSAFNVAALRCAGEVLEMSEEYCEDNLISKTERYLSQTVLRSLRDSIKTLKSCEDLLPMAESLGIVQRCIDSIVSKASSSDSSLFGWPVNEVSNSGTGAVSSSSRRTGAAGTGGGDRWFDELVFLSPPLFKRLIVAIKARDLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G030760`
TK1151 ID	TkA03G030760
OH-1004 ID	LXL04_006373
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 96.142 / OH-1004 49.923 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G030760

Location Chr03:8262926-8265503 (-)

Description Similar to At5g66560: BTB/POZ domain-containing protein At5g66560

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66560`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g50840`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g03250`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006373 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT3G50840

ath:AT5G03250

ath:AT5G13600

ath:AT5G66560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.720

Rank 1 · TkA03G030760 · TK1151

Cytoplasm0.269

Rank 2 · TkA03G030760 · TK1151

Cell membrane0.089

Rank 3 · TkA03G030760 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA03G030760 · TK1151

Lysosome / Vacuole0.023

Rank 5 · TkA03G030760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651BTB20-60 aa

PF24824PH_SPT1633-81 aa

PF03000NPH3147-189 aa

PF03000NPH3233-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G030760	`PF00651`	BTB	20	60	8.5e-06	26.6
TkA03G030760	`PF24824`	PH_SPT16	33	81	1.2	9.8
TkA03G030760	`PF03000`	NPH3	147	189	2.1e-15	57.8
TkA03G030760	`PF03000`	NPH3	233	312	2.1e-15	57.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A73`	Arabidopsis thaliana	sp\|Q94A73\|Y5656_ARATH BTB/POZ domain-containing protein At5g66560	51.300%	Swiss-Prot	High
`Q8LPQ3`	Arabidopsis thaliana	sp\|Q8LPQ3\|Y3084_ARATH BTB/POZ domain-containing protein At3g50840	43.500%	Swiss-Prot	Medium
`Q9S9Q9`	Arabidopsis thaliana	sp\|Q9S9Q9\|Y1044_ARATH BTB/POZ domain-containing protein At1g30440	43.600%	Swiss-Prot	Medium
`Q9LYW0`	Arabidopsis thaliana	sp\|Q9LYW0\|Y5325_ARATH BTB/POZ domain-containing protein At5g03250	42.100%	Swiss-Prot	Medium
`Q9FNB3`	Arabidopsis thaliana	sp\|Q9FNB3\|Y5360_ARATH Putative BTB/POZ domain-containing protein At5g13600	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card