TkA03G030690 | RubberDandelionOmics

Gene overview

TkA03G030690

Reference: TK1151 Chr: Chr03 Coordinates: 8248112-8249471 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkA03G030690|TK1151|cDNA

AAAACATGGAGAAGGCCGGACTTCCGGCACCTAATACGATTGCTAAAAACATGCAGCCCCATTCACTCCCACCTATTTTCACTTTCCTCCTCCTAAAAAATCGTACATTTGGACCCCAATCATGTGGCATATGCCTTCGATACTGTTCATACGGTTGATTTCTCGATCAATTTGGTGTTAGTTTAATTATACCCGAGTGTGAAAATGGTGAGGAGTGACATTTTGAGGTTGAAAGTGGACGAGGTGACGGCGGAGATACT...

CDS

Download CDS FASTA

609 bp · TkA03G030690|TK1151|CDS

ATGGTGAGGAGTGACATTTTGAGGTTGAAAGTGGACGAGGTGACGGCGGAGATACTCAACGCCGATATCACCGAGCTGAAGCTGTCCGTAGAGAGGTTGTTTGATCATGCCAGTAAGCTCGGCGGCTTAGGGTTCGGCACTTCCTTGCTTTCGTGGGTTGCATCCTTCTCTGCTATGTATTTGTTAATATTGGATCGAACAAACTGGAGATCGAACATGCTGACTTCACTTTTAGTACCTTACATATACTTCAGTCTTCC...

Protein

Download Protein FASTA

202 aa · TkA03G030690|TK1151|PROTEIN

MVRSDILRLKVDEVTAEILNADITELKLSVERLFDHASKLGGLGFGTSLLSWVASFSAMYLLILDRTNWRSNMLTSLLVPYIYFSLPPSLFHFFKGQFGVWVAFIAVVLRLFFPRQFPDWLEMPGSLILLLIVAPSLFAEGFRGSWIGIAICLMIGCYLLQEHIRASGGFRNSFMQSHGVSNTIGILLLLIYPMWRLIIRFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G030690`
TK1151 ID	TkA03G030690
OH-1004 ID	LXL04_006374
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G030690

Location Chr03:8248112-8249471 (-)

Description Similar to COR413PM2: Cold-regulated 413 plasma membrane protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50830`	Cold-regulated 413 plasma membrane protein 2.	No verified direct reference in this release
`At4g37220`	Cold-regulated 413 plasma membrane protein 4.	No verified direct reference in this release
`At2g15970`	Cold-regulated 413 plasma membrane protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006374 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009631 cold acclimation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ath:AT1G29390

ath:AT2G15970

ath:AT2G23680

ath:AT3G50830

ath:AT4G37220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.368

Rank 1 · TkA03G030690 · TK1151

Golgi apparatus0.221

Rank 2 · TkA03G030690 · TK1151

Plastid0.155

Rank 3 · TkA03G030690 · TK1151

Nucleus0.148

Rank 4 · TkA03G030690 · TK1151

Cytoplasm0.109

Rank 5 · TkA03G030690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05562WCOR41311-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G030690	`PF05562`	WCOR413	11	189	9.9e-85	283.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVL6`	Arabidopsis thaliana	sp\|Q9SVL6\|CRPM2_ARATH Cold-regulated 413 plasma membrane protein 2	64.700%	Swiss-Prot	High
`O23164`	Arabidopsis thaliana	sp\|O23164\|CRPM4_ARATH Cold-regulated 413 plasma membrane protein 4	55.300%	Swiss-Prot	High
`Q9XIM7`	Arabidopsis thaliana	sp\|Q9XIM7\|CRPM1_ARATH Cold-regulated 413 plasma membrane protein 1	59.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card