TkA03G024330 | RubberDandelionOmics

Gene overview

TkA03G024330

Reference: TK1151 Chr: Chr03 Coordinates: 6258961-6260126 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1022 bp · TkA03G024330|TK1151|cDNA

AAAGAACTGGTTACATCTCCTCTCATTCTCTGTCGCTCGCTCTCTTCTCTCTCGCGACTCTTGATGTAGATTTGGCACTCGACAATTACATGCCCGATTACATCTCTCTCAAAGTGTTTTTCTGATCGTCTTCCCCACTCAATTCTTCTGATTCCAAATATATCCATGAAATTGGGGGGGGAATCTAACCATCTTAAGGCATAAGAGGATAAGAGGATAACCATCTTCGCGAGATGAAGGTATCATACACTGCGCAATAA...

CDS

Download CDS FASTA

345 bp · TkA03G024330|TK1151|CDS

ATGTACCCACAGAACACAATCGCAGCTAAGCAAGAAGAAAGTTACGATTTCTTCGGAACACAAACTGGAACTGCTGAAGGTTTCGCCAAGGCCCTATTAGAGGAAGCCAAAATGCGCTACGAGAAGGCCTCATTCAAAGCAGTTGATTGGATGATTACGCTGCTGATGATGATGAGTATGAGGAGAGACTTAAAAAAGGATGTTTACCGGCTATTGAAAAATGTTACCGGCAAACCGGAAAAAATTGCTAAAACAAACAT...

Protein

Download Protein FASTA

114 aa · TkA03G024330|TK1151|PROTEIN

MYPQNTIAAKQEESYDFFGTQTGTAEGFAKALLEEAKMRYEKASFKAVDWMITLLMMMSMRRDLKKDVYRLLKNVTGKPEKIAKTNIFLQMLGFICPKTHLGTKPSTFDKCRDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G024330`
TK1151 ID	TkA03G024330
OH-1004 ID	LXL04_002927
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.400
Protein coverage (%)	TK1151 41.228 / OH-1004 8.051 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G024330

Location Chr03:6258961-6260126 (+)

Description Similar to CPR: NADPH--cytochrome P450 reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0243500`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes (By similarity).	Rice P450 reductases differentially affect P450-mediated metabolism in bacterial expression systems.2013 · DOI: 10.1007/s00449-012-0787-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002927 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003958 NADPH-hemoprotein reductase activity Molecular Function

GO:0010181 FMN binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G30210

dosa:Os09g0558900

osa:4347838

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.362

Rank 1 · TkA03G024330 · TK1151

Mitochondrion0.327

Rank 2 · TkA03G024330 · TK1151

Nucleus0.263

Rank 3 · TkA03G024330 · TK1151

Cell membrane0.088

Rank 4 · TkA03G024330 · TK1151

Extracellular0.077

Rank 5 · TkA03G024330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03279Lip_A_acyltrans3-33 aa

PF00258Flavodoxin_117-45 aa

PF03279Lip_A_acyltrans39-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G024330	`PF03279`	Lip_A_acyltrans	3	33	0.013	15.4
TkA03G024330	`PF00258`	Flavodoxin_1	17	45	0.0047	17.8
TkA03G024330	`PF03279`	Lip_A_acyltrans	39	87	0.013	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0J705`	Oryza sativa subsp. japonica	sp\|Q0J705\|NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2	84.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card