TkA03G020930 | RubberDandelionOmics

Gene overview

TkA03G020930

Reference: TK1151 Chr: Chr03 Coordinates: 5397929-5400618 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · TkA03G020930|TK1151|cDNA

AGCAAATCCTCTCTCTCATGCTACTTCCTGGAACCACCGTTTTCATCCAGATTCAATGCCTCACGTGCTATGCTTTTTCTTATATAAGTGTTCGGAATTCTTCTTCACTAGTGTCGAAAACTGAAAAACCTAATCAGAGATATTGAGTTGGAAGGAATACTTGAAGATTTGGAGATTTGGAGATTTGAAGGTTGAGGTATAATGACTGGTGATAATTTGGTGTTGCCGCCGGGGTTTAGATTCCATCCCACGGATGAAGA...

CDS

Download CDS FASTA

864 bp · TkA03G020930|TK1151|CDS

ATGACTGGTGATAATTTGGTGTTGCCGCCGGGGTTTAGATTCCATCCCACGGATGAAGAGTTGGTTATGCATTACCTTATTAAGAAATGCGCTTCGCAGACGATTTCGGTTCCGATTATTGCTGAGATTGATTTGTATAAGTTCGATCCATGGCAGCTTCCTGAGATGGCTCTGTATGGAGAAAAAGAATGGTACTTTTTTTCACCTAGAGACAGAAAGTATCCGAACGGATCTCGGCCTAATAGAGCTGCCGGAACAGG...

Protein

Download Protein FASTA

287 aa · TkA03G020930|TK1151|PROTEIN

MTGDNLVLPPGFRFHPTDEELVMHYLIKKCASQTISVPIIAEIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPKAVGIKKALVFYAGKAPRGVKTNWIMHEYRLANVDRSAGKRSNNLRLDDWVLCRIYNKKGVLEKHLNTNTKSIQYSEMEIETKPKIEAYSPGIETSSPNPPLSVSHHIMDDRFNFETSDSVPTLHTDSSSEHERGEVQSEAKRETFQYNYMDPFADDAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G020930`
TK1151 ID	TkA03G020930
OH-1004 ID	LXL04_024045
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.200
Protein coverage (%)	TK1151 88.153 / OH-1004 66.935 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G020930

Location Chr03:5397929-5400618 (+)

Description Similar to NAC002: NAC domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08790`	Involved in disease resistance response.	The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02488.x Interaction of the Tobacco mosaic virus replicase protein with a NAC domain transcription factor is associated with the suppression of systemic host defenses.2009 · DOI: 10.1128/jvi.00941-09 ATAF2, a NAC transcription factor, binds to the promoter and regulates NIT2 gene expression involved in auxin biosynthesis.2012 · DOI: 10.1007/s10059-012-0122-2 ATAF2 integrates Arabidopsis brassinosteroid inactivation and seedling photomorphogenesis.2015 · DOI: 10.1242/dev.124347
`At5g63790`	May be involved in regulation of seed germination under flooding.	No verified direct reference in this release
`At1g01720`	NAC domain-containing protein 2.	No verified direct reference in this release
`At1g77450`	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0884300`	Transcription activator that binds to the promoter of the stress response gene LEA19.	Functional analysis of a NAC-type transcription factor OsNAC6 involved in abiotic and biotic stress-responsive gene expression in rice.2007 · DOI: 10.1111/j.1365-313x.2007.03168.x Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice.2008 · DOI: 10.1007/s11103-008-9309-5 The histone deacetylase OsHDAC1 epigenetically regulates the OsNAC6 gene that controls seedling root growth in rice.2009 · DOI: 10.1111/j.1365-313x.2009.03908.x The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.2010 · DOI: 10.1007/s00438-010-0557-0 The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance.2017 · DOI: 10.1111/pbi.12673

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

KEGG gene cross-reference

ath:AT1G01720

ath:AT1G77450

ath:AT5G08790

ath:AT5G63790

dosa:Os01g0884300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA03G020930 · TK1151

Cytoplasm0.098

Rank 2 · TkA03G020930 · TK1151

Cell membrane0.041

Rank 3 · TkA03G020930 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA03G020930 · TK1151

Plastid0.016

Rank 5 · TkA03G020930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM9-132 aa

PF00866Ring_hydroxyl_B121-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G020930	`PF02365`	NAM	9	132	5.8e-49	166.4
TkA03G020930	`PF00866`	Ring_hydroxyl_B	121	165	0.21	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C598`	Arabidopsis thaliana	sp\|Q9C598\|NAC81_ARATH Protein ATAF2	82.100%	Swiss-Prot	Medium
`Q8H115`	Arabidopsis thaliana	sp\|Q8H115\|NA102_ARATH NAC domain-containing protein 102	84.000%	Swiss-Prot	Medium
`Q39013`	Arabidopsis thaliana	sp\|Q39013\|NAC2_ARATH NAC domain-containing protein 2	55.300%	Swiss-Prot	High
`Q9CAR0`	Arabidopsis thaliana	sp\|Q9CAR0\|NAC32_ARATH NAC transcription factor 32	80.500%	Swiss-Prot	Medium
`Q7F2L3`	Oryza sativa subsp. japonica	sp\|Q7F2L3\|NAC48_ORYSJ NAC domain-containing protein 48	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card