TkA03G020280 | RubberDandelionOmics

Gene overview

TkA03G020280

Reference: TK1151 Chr: Chr03 Coordinates: 5242292-5242888 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA03G020280|TK1151|cDNA

ATGAACATTGAACACCGATTTTCAAATAGAATCAGCGCTCTCCCTCAAGACACAATTGGAAAAATTCTAACTCATATGTCAATCCGAGATGCATTGAGGACAAGTGTTTTATCAAGAAAATGGAGGTATTCGTGGGCAAGCATGCCGAAACTAGTATTTGATGAAACACTAATCACAGTATATTCCAATAACGAAGAAACAGATAAATACAAAATGATCAGCGCGATCTTCCATGTTTTGTTGCTACATAAAGGTCGGAT...

CDS

Download CDS FASTA

468 bp · TkA03G020280|TK1151|CDS

ATGAACATTGAACACCGATTTTCAAATAGAATCAGCGCTCTCCCTCAAGACACAATTGGAAAAATTCTAACTCATATGTCAATCCGAGATGCATTGAGGACAAGTGTTTTATCAAGAAAATGGAGGTATTCGTGGGCAAGCATGCCGAAACTAGTATTTGATGAAACACTAATCACAGTATATTCCAATAACGAAGAAACAGATAAATACAAAATGATCAGCGCGATCTTCCATGTTTTGTTGCTACATAAAGGTCGGAT...

Protein

Download Protein FASTA

155 aa · TkA03G020280|TK1151|PROTEIN

MNIEHRFSNRISALPQDTIGKILTHMSIRDALRTSVLSRKWRYSWASMPKLVFDETLITVYSNNEETDKYKMISAIFHVLLLHKGRILEFVVCMADTTIVNEFDQIILHLSRSSDLKKFIFEKLRFHNVDITAKTLPRFLTNCPLIEEFTLMRSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G020280`
TK1151 ID	TkA03G020280
OH-1004 ID	LXL04_011160
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.300
Protein coverage (%)	TK1151 98.710 / OH-1004 37.711 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G020280

Location Chr03:5242292-5242888 (-)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At1g80960`	F-box protein At1g80960.	No verified direct reference in this release
`At1g67390`	Putative F-box protein At1g67390.	No verified direct reference in this release
`At5g53840`	F-box/FBD/LRR-repeat protein At5g53840.	No verified direct reference in this release
`At1g58310`	Putative F-box protein At1g58310.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011160 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G04230

ath:AT3G26922

ath:AT5G56370

ath:AT5G56440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · TkA03G020280 · TK1151

Nucleus0.495

Rank 2 · TkA03G020280 · TK1151

Endoplasmic reticulum0.062

Rank 3 · TkA03G020280 · TK1151

Cell membrane0.062

Rank 4 · TkA03G020280 · TK1151

Mitochondrion0.031

Rank 5 · TkA03G020280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box11-50 aa

PF12937F-box-like11-42 aa

PF00646F-box114-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G020280	`PF00646`	F-box	11	50	1.7e-08	34.7
TkA03G020280	`PF12937`	F-box-like	11	42	0.0084	16.6
TkA03G020280	`PF00646`	F-box	114	124	1.7e-08	34.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	45.600%	Swiss-Prot	Medium
`Q9SAG4`	Arabidopsis thaliana	sp\|Q9SAG4\|FB93_ARATH F-box protein At1g80960	36.400%	Swiss-Prot	Low
`Q9FYF4`	Arabidopsis thaliana	sp\|Q9FYF4\|FB77_ARATH Putative F-box protein At1g67390	36.300%	Swiss-Prot	Medium
`Q9FGQ3`	Arabidopsis thaliana	sp\|Q9FGQ3\|FDL37_ARATH F-box/FBD/LRR-repeat protein At5g53840	45.300%	Swiss-Prot	Low
`Q9LQC1`	Arabidopsis thaliana	sp\|Q9LQC1\|FB65_ARATH Putative F-box protein At1g58310	44.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card