TkA03G018680 | RubberDandelionOmics

Gene overview

TkA03G018680

Reference: TK1151 Chr: Chr03 Coordinates: 4907277-4911419 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1930 bp · TkA03G018680|TK1151|cDNA

AAGCTTTGATCAAGATTAACACTGCCGATTTCCAATTCGAGGTATAATTGCACGTAGCACCTGCAATCGCTCACAAAGGCACCTTGAAATGCTGCGAAGATTCATCGGGCAAGCTTCTATTGCACAACGATATCGATGCCTCATCAACCGGCAACCGTCAGCTGACGCTTTCCGTCGATGTTCCTCTTCGGCGACGGCGTCGTCTCAAGTTCCGGCGGGAACTTCCGTCGAACCGCCGAAGGACGCTCAGTTTTCCGATG...

CDS

Download CDS FASTA

1458 bp · TkA03G018680|TK1151|CDS

ATGCTGCGAAGATTCATCGGGCAAGCTTCTATTGCACAACGATATCGATGCCTCATCAACCGGCAACCGTCAGCTGACGCTTTCCGTCGATGTTCCTCTTCGGCGACGGCGTCGTCTCAAGTTCCGGCGGGAACTTCCGTCGAACCGCCGAAGGACGCTCAGTTTTCCGATGATTACACCGCTAAACCCTCCGCCAGGATTTCCGTTGACCGGTCGGGATTGAGCAATCCACCTGAACATTCTCATGAAACGTCGGCAGA...

Protein

Download Protein FASTA

485 aa · TkA03G018680|TK1151|PROTEIN

MLRRFIGQASIAQRYRCLINRQPSADAFRRCSSSATASSQVPAGTSVEPPKDAQFSDDYTAKPSARISVDRSGLSNPPEHSHETSADSELVKHLKSIIKFRGGPISVAEYMEEVLINPKAGFYINRDVFGAEGDFITSPEVSQMFGEMVGVWAMCLWEQMGQPEKVNLVELGPGRGTLMADLLRGASKFDKFTKSLHIHMIEVSPALKKIQKVTLKCDDDSEDENNQSTATTLTGTPVSWHSTLEEVPTGLPTIIVAHEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G018680`
TK1151 ID	TkA03G018680
OH-1004 ID	LXL04_006226
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G018680`
Location	Chr03:4907277-4911419 (-)
Description	Similar to midA: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006226` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005977 glycogen metabolic process Biological Process GO:0006536 glutamate metabolic process Biological Process GO:0006907 pinocytosis Biological Process GO:0006909 phagocytosis Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0019918 peptidyl-arginine methylation, to symmetrical-dimethyl arginine Biological Process GO:0030435 sporulation resulting in formation of a cellular spore Biological Process GO:0032259 methylation Biological Process GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process GO:0042331 phototaxis Biological Process GO:0043052 thermotaxis Biological Process GO:0046034 ATP metabolic process Biological Process
KEGG gene cross-reference	ddi:DDB_G0282615 dme:Dmel_CG17726 dre:767796 mmu:73694 rno:298748 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.892

Rank 1 · TkA03G018680 · TK1151

Cytoplasm0.100

Rank 2 · TkA03G018680 · TK1151

Nucleus0.062

Rank 3 · TkA03G018680 · TK1151

Plastid0.041

Rank 4 · TkA03G018680 · TK1151

Cell membrane0.017

Rank 5 · TkA03G018680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02636Methyltransf_28148-398 aa

PF26111Ig_Mok13190-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G018680	`PF02636`	Methyltransf_28	148	398	3.8e-66	223.8
TkA03G018680	`PF26111`	Ig_Mok13	190	257	0.027	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card