TkA03G015860 | RubberDandelionOmics

Gene overview

TkA03G015860

Reference: TK1151 Chr: Chr03 Coordinates: 4064327-4064855 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

333 bp · TkA03G015860|TK1151|cDNA

ATGATTTGTACAGGGGTATCTGTTGCCTTTATAATTGGAACAGTGCTGACATGGCGAATCTTGGCATTAACAGGATTGATCCATTGTGTTGTTCTATTAGTGGGGCTTTTCTTTGTACCAGAATCTCCTAGATGGCTCGGGTGGACCTTTATGCCCATGCGTTTGTTGCTGCTACATTTTTGGACCCTTTTGCCCTTCTCTTGGGGGCTGTTTGTCTTGGTGAGGGTCTTGATTGCAGGATCCTTATATATCTTAGATCT...

CDS

Download CDS FASTA

333 bp · TkA03G015860|TK1151|CDS

ATGATTTGTACAGGGGTATCTGTTGCCTTTATAATTGGAACAGTGCTGACATGGCGAATCTTGGCATTAACAGGATTGATCCATTGTGTTGTTCTATTAGTGGGGCTTTTCTTTGTACCAGAATCTCCTAGATGGCTCGGGTGGACCTTTATGCCCATGCGTTTGTTGCTGCTACATTTTTGGACCCTTTTGCCCTTCTCTTGGGGGCTGTTTGTCTTGGTGAGGGTCTTGATTGCAGGATCCTTATATATCTTAGATCT...

Protein

Download Protein FASTA

110 aa · TkA03G015860|TK1151|PROTEIN

MICTGVSVAFIIGTVLTWRILALTGLIHCVVLLVGLFFVPESPRWLGWTFMPMRLLLLHFWTLLPFSWGLFVLVRVLIAGSLYILDLMTLYFLLLSLWNLIQNNYLVSQM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G015860`
TK1151 ID	TkA03G015860
OH-1004 ID	LXL04_006181
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.800
Protein coverage (%)	TK1151 41.818 / OH-1004 29.114 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G015860

Location Chr03:4064327-4064855 (-)

Description Similar to At2g48020: Sugar transporter ERD6-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g48020`	Sugar transporter.	No verified direct reference in this release
`At1g54730`	Sugar transporter.	No verified direct reference in this release
`At5g18840`	Sugar transporter.	No verified direct reference in this release
`At3g05155`	Sugar transporter.	No verified direct reference in this release
`At3g05165`	Sugar transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006181 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G54730

ath:AT2G48020

ath:AT3G05155

ath:AT3G20460

ath:AT5G18840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.514

Rank 1 · TkA03G015860 · TK1151

Nucleus0.133

Rank 2 · TkA03G015860 · TK1151

Cytoplasm0.129

Rank 3 · TkA03G015860 · TK1151

Mitochondrion0.108

Rank 4 · TkA03G015860 · TK1151

Golgi apparatus0.100

Rank 5 · TkA03G015860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr12-46 aa

PF11934DUF345263-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G015860	`PF00083`	Sugar_tr	12	46	7.3e-05	22.5
TkA03G015860	`PF11934`	DUF3452	63	104	1.0	9.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93051`	Arabidopsis thaliana	sp\|P93051\|ERDL7_ARATH Sugar transporter ERD6-like 7	68.100%	Swiss-Prot	Low
`Q3ECP7`	Arabidopsis thaliana	sp\|Q3ECP7\|ERDL5_ARATH Sugar transporter ERD6-like 5	59.600%	Swiss-Prot	Low
`Q8LBI9`	Arabidopsis thaliana	sp\|Q8LBI9\|EDL16_ARATH Sugar transporter ERD6-like 16	61.700%	Swiss-Prot	Low
`Q7XA64`	Arabidopsis thaliana	sp\|Q7XA64\|ERDL9_ARATH Sugar transporter ERD6-like 9	58.100%	Swiss-Prot	Low
`Q94AF9`	Arabidopsis thaliana	sp\|Q94AF9\|EDL11_ARATH Sugar transporter ERD6-like 11	50.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card