TkA03G012230 | RubberDandelionOmics

Gene overview

TkA03G012230

Reference: TK1151 Chr: Chr03 Coordinates: 3150550-3154010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1624 bp · TkA03G012230|TK1151|cDNA

CCCCAATATGCTTCAATAAAAGTATAAAACAACTCATCGTCACTCTATGCTCACGCAGCAGGAATCTCCGAACAGTCATGGCTGCATATTCATTCCTCTCCACATACTCCTCTTCTCCAACTCTCCCTCCTCGATTCTCTTCCCCAAATCGTCTCCCAAGCTCCACACTTCCTCCATCAACAAACTTCCCTCCCCGCAATCTCCGTAGCACCTGCATCGTCGCTTCTCTCCGCCACACTCACGGTAACCATTCGCCGGTG...

CDS

Download CDS FASTA

1293 bp · TkA03G012230|TK1151|CDS

ATGGCTGCATATTCATTCCTCTCCACATACTCCTCTTCTCCAACTCTCCCTCCTCGATTCTCTTCCCCAAATCGTCTCCCAAGCTCCACACTTCCTCCATCAACAAACTTCCCTCCCCGCAATCTCCGTAGCACCTGCATCGTCGCTTCTCTCCGCCACACTCACGGTAACCATTCGCCGGTGCCGGAATCCACCGTCAATAAGTTTCTAGATTCGTTAGTCGTATTGATCACTTCTGTAGCACTATCCGTCTCAATTTT...

Protein

Download Protein FASTA

430 aa · TkA03G012230|TK1151|PROTEIN

MAAYSFLSTYSSSPTLPPRFSSPNRLPSSTLPPSTNFPPRNLRSTCIVASLRHTHGNHSPVPESTVNKFLDSLVVLITSVALSVSIFVTDIDSAAAFVVTPSRKLQTDELATVRLFQDNTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNYHVIRGASDLRVTLADQTTYDAKVVGFDQDKDVAVLRIDASKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G012230`
TK1151 ID	TkA03G012230
OH-1004 ID	LXL04_006278
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.900
Protein coverage (%)	TK1151 76.047 / OH-1004 68.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G012230

Location Chr03:3150550-3154010 (-)

Description Similar to DEGP8: Protease Do-like 8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27925`	Serine protease that is required at high temperature.	High light stimulates Deg1-dependent cleavage of the minor LHCII antenna proteins CP26 and CP29 and the PsbS protein in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1505-x Identification and characterization of DegP, a serine protease associated with the luminal side of the thylakoid membrane.1998 · DOI: 10.1074/jbc.273.12.7094
`At5g39830`	Probable serine protease.	No verified direct reference in this release
`At4g18370`	Probable serine protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006278 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT3G27925

ath:AT4G18370

ath:AT5G39830

bme:BMEI1330

bmel:DK63_73

bms:BR0611

bsi:BS1330_I0607

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.985

Rank 1 · TkA03G012230 · TK1151

Mitochondrion0.025

Rank 2 · TkA03G012230 · TK1151

Cytoplasm0.016

Rank 3 · TkA03G012230 · TK1151

Peroxisome0.012

Rank 4 · TkA03G012230 · TK1151

Nucleus0.010

Rank 5 · TkA03G012230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05579Peptidase_S32138-196 aa

PF02907Peptidase_S29145-161 aa

PF13365Trypsin_2148-287 aa

PF00089Trypsin149-309 aa

PF17820PDZ_6216-229 aa

PF10459Peptidase_S46266-288 aa

PF02907Peptidase_S29267-310 aa

PF05579Peptidase_S32269-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G012230	`PF05579`	Peptidase_S32	138	196	0.011	15.7
TkA03G012230	`PF02907`	Peptidase_S29	145	161	0.013	16.0
TkA03G012230	`PF13365`	Trypsin_2	148	287	7.2e-37	128.1
TkA03G012230	`PF00089`	Trypsin	149	309	1.1e-18	68.6
TkA03G012230	`PF17820`	PDZ_6	216	229	4.2e-05	23.9
TkA03G012230	`PF10459`	Peptidase_S46	266	288	0.18	11.1
TkA03G012230	`PF02907`	Peptidase_S29	267	310	0.013	16.0
TkA03G012230	`PF05579`	Peptidase_S32	269	290	0.011	15.7
TkA03G012230	`PF13180`	PDZ_2	326	421	1.2e-12	48.6
TkA03G012230	`PF17820`	PDZ_6	353	362	4.2e-05	23.9
TkA03G012230	`PF00595`	PDZ	371	397	0.051	14.7
TkA03G012230	`PF17820`	PDZ_6	373	412	4.2e-05	23.9
TkA03G012230	`PF14685`	PDZ_Tricorn	375	414	0.16	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22609`	Arabidopsis thaliana	sp\|O22609\|DEGP1_ARATH Protease Do-like 1, chloroplastic	90.500%	Swiss-Prot	High
`Q9LU10`	Arabidopsis thaliana	sp\|Q9LU10\|DEGP8_ARATH Protease Do-like 8, chloroplastic	46.900%	Swiss-Prot	Medium
`Q9SEL7`	Arabidopsis thaliana	sp\|Q9SEL7\|DEGP5_ARATH Protease Do-like 5, chloroplastic	49.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card