TkA03G009150 | RubberDandelionOmics

Gene overview

TkA03G009150

Reference: TK1151 Chr: Chr03 Coordinates: 2262094-2264723 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1849 bp · TkA03G009150|TK1151|cDNA

CCTACAAGAATCTATAAATTGTCGTTTATATGAAACTATAATATTAAATTTTATTCTTGTTTATCAAATTCAATGGCAATATGGCATCTCGCCCAATTCTTCTTTCCATCTCTTTTCCCTTTTTCTCACCTAAATTTTATAATTGAATTAAATAAGAGTTTTTTGTCAGAACGACTCGCAATTCCCTCTCCCTTATCTTGCCGATCAAGAACGCAACAACACAATCCCCACATAAAGCCTAAAACTTTAACTATCTACTA...

CDS

Download CDS FASTA

831 bp · TkA03G009150|TK1151|CDS

ATGTTGTCTAAAGTCCAACACAAGAACTTAGTAAAGTTTATTGGAGCTTGTAAGAAACCAATCATGGTGATAGTAACCGAGCTTCTTACCGGTGGCACATTACGTAAATATTTGGTAAATATGCGACCTAGAGGTTTGTTGGATACACGTGTCGCTATTGGATTCGCCCTTGATATAGCTCGCGCTATGGAATGCTTACACTCGCATGGAATCATTCACCGTGATTTAAAACCTGAAAACTTGTTGTTGACATCCGATCA...

Protein

Download Protein FASTA

276 aa · TkA03G009150|TK1151|PROTEIN

MLSKVQHKNLVKFIGACKKPIMVIVTELLTGGTLRKYLVNMRPRGLLDTRVAIGFALDIARAMECLHSHGIIHRDLKPENLLLTSDHKSIKLADFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDAYSFAIVLWELIQNKLPFEGMSNLQAAYAAAFKNVRPSSDELPEDLALIVTSCWMEDPNGRPNFSQIIQMLHHYLSTTTTLSPPMTATVPPRMFNVFLPDSPGTSTLISKKDEIPTTPLH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G009150`
TK1151 ID	TkA03G009150
OH-1004 ID	LXL04_013265
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.300
Protein coverage (%)	TK1151 99.275 / OH-1004 78.431 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G009150

Location Chr03:2262094-2264723 (-)

Description Similar to HT1: Serine/threonine/tyrosine-protein kinase HT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g38470`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At2g17700`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At1g14000`	Serine/threonine protein kinase which may function as an adapter protein for BRL2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:2000030 regulation of response to red or far red light Biological Process

KEGG gene cross-reference

ath:AT1G62400

ath:AT2G17700

ath:AT2G24360

ath:AT4G35780

ath:AT4G38470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · TkA03G009150 · TK1151

Cell membrane0.310

Rank 2 · TkA03G009150 · TK1151

Nucleus0.239

Rank 3 · TkA03G009150 · TK1151

Golgi apparatus0.089

Rank 4 · TkA03G009150 · TK1151

Lysosome / Vacuole0.060

Rank 5 · TkA03G009150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr1-211 aa

PF00069Pkinase1-210 aa

PF13095FTA217-82 aa

PF06293Kdo56-98 aa

PF14531Kinase-like57-179 aa

PF17667Pkinase_fungal60-130 aa

PF03109ABC163-101 aa

PF01636APH67-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G009150	`PF07714`	PK_Tyr_Ser-Thr	1	211	1.8e-46	159.2
TkA03G009150	`PF00069`	Pkinase	1	210	3.4e-42	145.4
TkA03G009150	`PF13095`	FTA2	17	82	0.21	12.0
TkA03G009150	`PF06293`	Kdo	56	98	0.0082	16.3
TkA03G009150	`PF14531`	Kinase-like	57	179	0.00028	21.0
TkA03G009150	`PF17667`	Pkinase_fungal	60	130	7.5e-05	22.3
TkA03G009150	`PF03109`	ABC1	63	101	0.004	17.1
TkA03G009150	`PF01636`	APH	67	97	0.078	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ31`	Arabidopsis thaliana	sp\|Q9ZQ31\|STY13_ARATH Serine/threonine-protein kinase STY13	49.100%	Swiss-Prot	Medium
`Q8RWL6`	Arabidopsis thaliana	sp\|Q8RWL6\|STY17_ARATH Serine/threonine-protein kinase STY17	43.300%	Swiss-Prot	Medium
`F4JTP5`	Arabidopsis thaliana	sp\|F4JTP5\|STY46_ARATH Serine/threonine-protein kinase STY46	44.900%	Swiss-Prot	Medium
`O22558`	Arabidopsis thaliana	sp\|O22558\|STY8_ARATH Serine/threonine-protein kinase STY8	42.400%	Swiss-Prot	Medium
`Q9XI87`	Arabidopsis thaliana	sp\|Q9XI87\|VIK_ARATH Serine/threonine-protein kinase VIK	39.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card