Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1025 bp · TkA03G009100|TK1151|cDNA
CGTCTTCTCTCGTCCCCTCCCCCGCGAAACTTCTCAAAAGTTCCATCATTTTTTCCGATGAAGAATTACTTTCCGCTTTGCATTTCGTCAAAGCCTTAAAGAATTCTTCAAGTGTAAGCTCACGAACACAGATGATTTTTTCCACGACACGATCTTGAAAAAAAGCTCGGAGATTTGTTGAAAAGTTTGAGGAGAAATATAAAAAAATTTCAAATATGTCCTCACCAGATGTTGCAGGAATGTTGGATCAATCAAAGGAG...
810 bp · TkA03G009100|TK1151|CDS
ATGTCCTCACCAGATGTTGCAGGAATGTTGGATCAATCAAAGGAGCTTGATCGTTTAAGAAACGAACAAGAAGGTATACTTAGTGAGATCAACAAGATGCACAAAAAGCTACAATCTACTCCTGAGGTTGTTGAGAAGCCTGGTGATAATTCACTTTCAAGGCTTAAGATGCTTTACATTCAAGCAAAAGAACTTTCAGAAAGTGAAGTGGCTGTTTCAAGCCAATTGTTAGTTCAATTGGATGCTCTGATACCCTCTGG...
Protein
Download Protein FASTA269 aa · TkA03G009100|TK1151|PROTEIN
MSSPDVAGMLDQSKELDRLRNEQEGILSEINKMHKKLQSTPEVVEKPGDNSLSRLKMLYIQAKELSESEVAVSSQLLVQLDALIPSGPPGQQRRRMAEGNEQKKKRMKADPDVPRLSPSLRNHLEHLASLKGEQVAARVTLEDADKDEWFIVKVIHFDRETREFEVLDEEPGDDEEPAGQRKYKLPMSHIIPFPKRNDPSTAQDFPPGKHVLAVYPGTTALYKATVVNTRKVLLSSYVLEFDDDEEDGSLPQRHVPFHKV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G009100 |
|---|---|
| TK1151 ID | TkA03G009100 |
| OH-1004 ID | LXL04_006092 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G009100 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:2241082-2245625 (-) | |||||||||
| Description | Similar to SGF29A: SAGA-associated factor 29 homolog A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009651 response to salt stress Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0043484 regulation of RNA splicing Biological Process GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045995 regulation of embryonic development Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G27460 ath:AT5G40550 hsa:112869 mmu:75565 rno:293488 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07039SGF29_Tudor19-36 aaPF07039SGF29_Tudor131-264 aaPF18115Tudor_3209-246 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G009100 | PF07039 | SGF29_Tudor | 19 | 36 | 1.7e-33 | 116.2 |
| TkA03G009100 | PF07039 | SGF29_Tudor | 131 | 264 | 1.7e-33 | 116.2 |
| TkA03G009100 | PF18115 | Tudor_3 | 209 | 246 | 0.16 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.