TkA02G616160 | RubberDandelionOmics

Gene overview

TkA02G616160

Reference: TK1151 Chr: Chr02 Coordinates: 158852309-158855446 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1710 bp · TkA02G616160|TK1151|cDNA

GAGAAGTGTGTTATTTATGAGGTAGGATTACCCGCCCTTCATCCCACCGTGCCCCGACTATCGCCGGTCTCGTTTTTAGGGTTTACCGAAGAGCACACCGAGTCAAAGTCATAGTTACCAAAGAGCATACCGAGTCAGTGACGGAGCTTAACCCTTTCCATCCGAAGAAATATGAGCACCTCCTCTAGAGAGTATTCTCCAGATTGGCTTCGTAATGACCAGGCACCACCAACATCAATTTTGATGTTGTCATCAAGTTC...

CDS

Download CDS FASTA

993 bp · TkA02G616160|TK1151|CDS

ATGAGCACCTCCTCTAGAGAGTATTCTCCAGATTGGCTTCGTAATGACCAGGCACCACCAACATCAATTTTGATGTTGTCATCAAGTTCTGAATCTCTTCCGGGTGGTAGCCCTTTAAGTGATGATGATAAAGATGATCAGCTTCCTATAAGCTCTGTGACCAAGAAAACATCACAAGTGAAGTCTCCAAGTACAAAGAGGAAGGGGCTTGGTGAAAGTGGAGGTAACAAGGGGGGTAGGAAAGCTGCAATGGGAAAAAC...

Protein

Download Protein FASTA

330 aa · TkA02G616160|TK1151|PROTEIN

MSTSSREYSPDWLRNDQAPPTSILMLSSSSESLPGGSPLSDDDKDDQLPISSVTKKTSQVKSPSTKRKGLGESGGNKGGRKAAMGKTPEKVTKPQEPKIPVWTLASDSEHEHETKEEDNVEELQSSTKKKKLKMEDMETKQENDVKVLERQKQTGSYVSSSRLPLVLADKVQRSKALVECEGESIDLSGDLGSVGRVVVSSGNQDVLLDLKGTIYKMAILPSRTFCVVSFGQSEAKVEAIMDDFIQLKPQSNVYEAETMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G616160`
TK1151 ID	TkA02G616160
OH-1004 ID	LXL04_011782
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G616160

Location Chr02:158852309-158855446 (-)

Description Similar to BIN4: DNA-binding protein BIN4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24630`	Component of the DNA topoisomerase VI complex.	BIN4, a novel component of the plant DNA topoisomerase VI complex, is required for endoreduplication in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054833

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011782 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010090 trichome morphogenesis Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0051276 chromosome organization Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009330 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex Cellular Component

GO:0003690 double-stranded DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G24630

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA02G616160 · TK1151

Cytoplasm0.134

Rank 2 · TkA02G616160 · TK1151

Cell membrane0.016

Rank 3 · TkA02G616160 · TK1151

Mitochondrion0.016

Rank 4 · TkA02G616160 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA02G616160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02724CDC45107-154 aa

PF30948BIN4163-248 aa

PF02724CDC45246-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G616160	`PF02724`	CDC45	107	154	8.1	5.3
TkA02G616160	`PF30948`	BIN4	163	248	1.4e-39	135.3
TkA02G616160	`PF02724`	CDC45	246	326	8.1	5.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLU1`	Arabidopsis thaliana	sp\|Q9FLU1\|BIN4_ARATH DNA-binding protein BIN4	77.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card