TkA02G614930 | RubberDandelionOmics

Gene overview

TkA02G614930

Reference: TK1151 Chr: Chr02 Coordinates: 158548499-158549877 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

745 bp · TkA02G614930|TK1151|cDNA

GGTGGTTACCATGGTTTGTAGAAAGGACCAGACGTTCCTAGATTTCTAACATCTGTATCTACTTTCCTTAAAAGCTTTGCATATCAAGTATATGGATAATCTACCTGCGGATCTCTGTTCTAAAATCTTCTGTTTATTGGATCATAAAGACCTCGTAACAGCCCAGCAAGTGTGCAGGAAGTGGAAGGTGTTTGGTTCGGAAAATGGGCTTTGGTGTAACCTATTTAAAGAAAGATGGGGAATAGACCGAGCCATATTTT...

CDS

Download CDS FASTA

471 bp · TkA02G614930|TK1151|CDS

ATGGATAATCTACCTGCGGATCTCTGTTCTAAAATCTTCTGTTTATTGGATCATAAAGACCTCGTAACAGCCCAGCAAGTGTGCAGGAAGTGGAAGGTGTTTGGTTCGGAAAATGGGCTTTGGTGTAACCTATTTAAAGAAAGATGGGGAATAGACCGAGCCATATTTTATGCACCCGTTGATTCAAAAACATGGAAAGATGCATATGCAGTTCAAGATCGGTGTGATCGTGTTGGATTGGGGCTGAAGATCATAAGGGA...

Protein

Download Protein FASTA

156 aa · TkA02G614930|TK1151|PROTEIN

MDNLPADLCSKIFCLLDHKDLVTAQQVCRKWKVFGSENGLWCNLFKERWGIDRAIFYAPVDSKTWKDAYAVQDRCDRVGLGLKIIREGDDYFLIHQGQIQRHLGSRSLQQLETGTSSHADEFAGRHDRQMGILDRILFFIGDLETDSAPAKRGRLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G614930`
TK1151 ID	TkA02G614930
OH-1004 ID	LXL04_011805
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G614930`
Location	Chr02:158548499-158549877 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011805` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006974 DNA damage response Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007219 Notch signaling pathway Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0010992 ubiquitin recycling Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0031398 positive regulation of protein ubiquitination Biological Process GO:0031648 protein destabilization Biological Process GO:0034644 cellular response to UV Biological Process GO:0042752 regulation of circadian rhythm Biological Process
KEGG gene cross-reference	rno:100360914 spo:2539767 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.422

Rank 1 · TkA02G614930 · TK1151

Nucleus0.395

Rank 2 · TkA02G614930 · TK1151

Mitochondrion0.160

Rank 3 · TkA02G614930 · TK1151

Cell membrane0.072

Rank 4 · TkA02G614930 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA02G614930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like1-45 aa

PF00646F-box2-38 aa

PF29466F-box_COS1112-32 aa

PF00646F-box62-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G614930	`PF12937`	F-box-like	1	45	3.4e-12	46.6
TkA02G614930	`PF00646`	F-box	2	38	5.4e-08	33.2
TkA02G614930	`PF29466`	F-box_COS111	2	32	0.29	12.4
TkA02G614930	`PF00646`	F-box	62	67	5.4e-08	33.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card