TkA02G614700 | RubberDandelionOmics

Gene overview

TkA02G614700

Reference: TK1151 Chr: Chr02 Coordinates: 158522204-158523941 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1583 bp · TkA02G614700|TK1151|cDNA

CTTCATTCTCTCAACTATACAAAGCATCTTTTTTAGGACTTTCACCATTGTTCACCATCACCATGGTTCCAGAATTAGAGAAACCAAAAGTTACCGAAATACAAGTCCGCATGGACTGCAATGGGTGTGTTCAAAAGATCAAGAAAGCTCTACATGGTATCAATGGTATATATGATATCTATATTGATATGCCACAACAGAAGTTGGCGATAATCGGGTGGGCTGACCAAGAAAAGATCGTGAAAGCAATCAAGAAAACG...

CDS

Download CDS FASTA

1149 bp · TkA02G614700|TK1151|CDS

ATGGTTCCAGAATTAGAGAAACCAAAAGTTACCGAAATACAAGTCCGCATGGACTGCAATGGGTGTGTTCAAAAGATCAAGAAAGCTCTACATGGTATCAATGGTATATATGATATCTATATTGATATGCCACAACAGAAGTTGGCGATAATCGGGTGGGCTGACCAAGAAAAGATCGTGAAAGCAATCAAGAAAACGAGAAAATCCGCGATCATATGTTCGGAGTCAGAGCCACCACCGCCAGACGGAGACCATGCAAG...

Protein

Download Protein FASTA

382 aa · TkA02G614700|TK1151|PROTEIN

MVPELEKPKVTEIQVRMDCNGCVQKIKKALHGINGIYDIYIDMPQQKLAIIGWADQEKIVKAIKKTRKSAIICSESEPPPPDGDHASPSGEQTPINEPQNQPPDAGETPQPTECQANEPVGSKVEEVHVVYRYPADDRSHGGLRFSHKPPQPVHVNHSYNMYMPTPHVNEYEYIRPPQYVSYNRPEPPPRYTAYSWPEPPQHYRQYNFPEPPPPQRYSRPPPPQTYGRLDPPPQDYQRQEQTPQNYGQQEPPPQIYDCPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G614700`
TK1151 ID	TkA02G614700
OH-1004 ID	LXL04_026011
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.800
Protein coverage (%)	TK1151 45.026 / OH-1004 50.234 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G614700

Location Chr02:158522204-158523941 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39700`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026011 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G56891

ath:AT4G08570

ath:AT4G35060

ath:AT4G39700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.466

Rank 1 · TkA02G614700 · TK1151

Nucleus0.382

Rank 2 · TkA02G614700 · TK1151

Cell membrane0.320

Rank 3 · TkA02G614700 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA02G614700 · TK1151

Mitochondrion0.032

Rank 5 · TkA02G614700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403HMA14-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G614700	`PF00403`	HMA	14	67	4.7e-12	46.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65657`	Arabidopsis thaliana	sp\|O65657\|HIP23_ARATH Heavy metal-associated isoprenylated plant protein 23	45.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card