Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2061 bp · TkA02G614690|TK1151|cDNA
ATGGTGGCGATAGGGACGATACCAGAGACGATAAAGGCGAAAAGTGATAGAGATCATTGGGTAAGAGTAAGGGATTGGAAGGCCGGTCGTGAGATGCTACATATAGGGGAAAGAGGTGAGAACGGCGACTCCTCCGCTGCCGACGCCTCCGCTGCCGACGTCTCCGCTATCGTCGCACCACAGCAGCTAGCTTGCACCACCGCTATCGTCGCACCACAGCAGCAATCGTCGCACACTCGCACCACTGATCGAACAGTGGG...
2061 bp · TkA02G614690|TK1151|CDS
ATGGTGGCGATAGGGACGATACCAGAGACGATAAAGGCGAAAAGTGATAGAGATCATTGGGTAAGAGTAAGGGATTGGAAGGCCGGTCGTGAGATGCTACATATAGGGGAAAGAGGTGAGAACGGCGACTCCTCCGCTGCCGACGCCTCCGCTGCCGACGTCTCCGCTATCGTCGCACCACAGCAGCTAGCTTGCACCACCGCTATCGTCGCACCACAGCAGCAATCGTCGCACACTCGCACCACTGATCGAACAGTGGG...
Protein
Download Protein FASTA686 aa · TkA02G614690|TK1151|PROTEIN
MVAIGTIPETIKAKSDRDHWVRVRDWKAGREMLHIGERGENGDSSAADASAADVSAIVAPQQLACTTAIVAPQQQSSHTRTTDRTVGLAELTLLTIHRVRMESANIRDVLTSFSPSLDFLAISSGDGRIKIWDTIKGHVQTDFANIVSTDETDFFAKPEGGHLSVDYTCMKWLSLEKKKKRKLRSSLLVLGTGGGDVLALDVSAGQLKWRVSDCHPGGVTALSFPTNGSGIMFTAGVDGMMCELDSLTGNLLGKFKASTK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G614690 |
|---|---|
| TK1151 ID | TkA02G614690 |
| OH-1004 ID | LXL04_011801 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 99.564Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G614690 |
|---|---|
| Location | Chr02:158516924-158521831 (+) |
| Description | Similar to Wdr43: WD repeat-containing protein 43 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006508 proteolysis Biological Process GO:0007017 microtubule-based process Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0034243 regulation of transcription elongation by RNA polymerase II Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process GO:0048871 multicellular organismal-level homeostasis Biological Process GO:0060271 cilium assembly Biological Process GO:2000036 regulation of stem cell population maintenance Biological Process GO:2000234 positive regulation of rRNA processing Biological Process |
| KEGG gene cross-reference | ana:all2124 hsa:23160 mmu:72515 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25172Beta-prop_WDR3_2nd43-131 aaPF24814WD40_Prp1962-143 aaPF23775Beta-prop_RIG_2nd82-147 aaPF23414Beta-prop_EML_286-136 aaPF23411Beta-prop_Vps4190-136 aaPF25174Beta-prop_THOC395-140 aaPF23756Beta-prop_HPS595-135 aaPF25168Beta-prop_WDR36-Utp21_2nd98-139 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G614690 | PF25172 | Beta-prop_WDR3_2nd | 43 | 131 | 3.5e-08 | 33.7 |
| TkA02G614690 | PF24814 | WD40_Prp19 | 62 | 143 | 1.4e-17 | 64.4 |
| TkA02G614690 | PF23775 | Beta-prop_RIG_2nd | 82 | 147 | 0.00026 | 21.2 |
| TkA02G614690 | PF23414 | Beta-prop_EML_2 | 86 | 136 | 1.1e-14 | 55.2 |
| TkA02G614690 | PF23411 | Beta-prop_Vps41 | 90 | 136 | 0.01 | 15.9 |
| TkA02G614690 | PF25174 | Beta-prop_THOC3 | 95 | 140 | 5e-16 | 59.2 |
| TkA02G614690 | PF23756 | Beta-prop_HPS5 | 95 | 135 | 0.0015 | 18.5 |
| TkA02G614690 | PF25168 | Beta-prop_WDR36-Utp21_2nd | 98 | 139 | 3.2e-10 | 40.5 |
| TkA02G614690 | PF00400 | WD40 | 105 | 133 | 1.4e-19 | 70.4 |
| TkA02G614690 | PF24817 | WD40_WDHD1_1st | 105 | 143 | 1e-12 | 48.6 |
| TkA02G614690 | PF25047 | Beta-prop_TEP1_2nd | 107 | 143 | 6.3e-08 | 32.8 |
| TkA02G614690 | PF25175 | Beta-prop_WDR5 | 112 | 142 | 2.2e-18 | 67.3 |
| TkA02G614690 | PF23381 | Beta-prop_IFT122_1st | 112 | 134 | 1.1e-14 | 55.2 |
| TkA02G614690 | PF25173 | Beta-prop_WDR3_1st | 112 | 139 | 4.3e-14 | 53.4 |
| TkA02G614690 | PF24807 | WD40_CDC20-Fz | 112 | 142 | 1.1e-13 | 51.9 |
| TkA02G614690 | PF25171 | Beta-prop_WDR36-Utp21_1st | 112 | 241 | 3.6e-11 | 43.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.