TkA02G611090 | RubberDandelionOmics

Gene overview

TkA02G611090

Reference: TK1151 Chr: Chr02 Coordinates: 157644928-157648481 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2469 bp · TkA02G611090|TK1151|cDNA

AGGCCCTGAAGTCTGAAGATCGATTTGTAATTGCGCGTTGGGGATGTTGAATCTGTTAAATTGCTTATTTTATGCGTTAGTCAACGCCTGTCTTCTTACAGTCCAAATCTCTATGCAGCTCTGCTGTTGAAATCACTAATTTGTGAGTTTTCTTCAGCAACGATCTGAAACTACCAAATGATTGTCTCTGGCCTTTTAACGTCTGTTGCGATCAATTTTACCCTTTGTATAATCTTCTTCATCTTGTATTCGGTGTTGAG...

CDS

Download CDS FASTA

1692 bp · TkA02G611090|TK1151|CDS

ATGATTGTCTCTGGCCTTTTAACGTCTGTTGCGATCAATTTTACCCTTTGTATAATCTTCTTCATCTTGTATTCGGTGTTGAGGAAACAACCTGGTAATTATAAAGTATATGCTCCGCGTTTGCTTGCTGAGGGGAGAGCCGAGCGACCAAGTCGATTCAAAATACTCAGGCTGTTACCAACTGCTGGTTGGTTGAAAAACGCATGGCAGCCTTCAGAAGATGAACTGCTGGCACATTCAGGGCTTGATGCTGTGGTATT...

Protein

Download Protein FASTA

563 aa · TkA02G611090|TK1151|PROTEIN

MIVSGLLTSVAINFTLCIIFFILYSVLRKQPGNYKVYAPRLLAEGRAERPSRFKILRLLPTAGWLKNAWQPSEDELLAHSGLDAVVFMRIITFSLKVFTIAGFIGIFILVPVNCSGTQLQIFDFANISNNSLELFSISNVNNGSNSLWIHLGAVYLLTIIACYFLYSEYKYISQKRIDYFCSLEPQPNQFTILVSNIPVPKGTSVGQNVENFFTQNHPATYLSHVVVHRKRKIWTIANAAKKLLRKTINFIKVRHEPQFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G611090`
TK1151 ID	TkA02G611090
OH-1004 ID	LXL04_011443
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 88.988 / OH-1004 66.800 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G611090

Location Chr02:157644928-157648481 (-)

Description Similar to At1g69450: CSC1-like protein At1g69450

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69450`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At3g01100`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g58520`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g10090`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g62320`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011443 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007231 osmosensory signaling pathway Biological Process

GO:0045087 innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005227 calcium-activated cation channel activity Molecular Function

GO:0008381 mechanosensitive monoatomic ion channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G10090

ath:AT1G58520

ath:AT1G69450

ath:AT3G01100

ath:AT4G02900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.372

Rank 1 · TkA02G611090 · TK1151

Lysosome / Vacuole0.269

Rank 2 · TkA02G611090 · TK1151

Endoplasmic reticulum0.196

Rank 3 · TkA02G611090 · TK1151

Cytoplasm0.131

Rank 4 · TkA02G611090 · TK1151

Golgi apparatus0.108

Rank 5 · TkA02G611090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02714RSN1_7TM3-24 aa

PF13967RSN1_TM6-168 aa

PF14703PHM7_cyt189-248 aa

PF14703PHM7_cyt275-324 aa

PF02714RSN1_7TM337-529 aa

PF13967RSN1_TM340-364 aa

PF13967RSN1_TM438-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G611090	`PF02714`	RSN1_7TM	3	24	6.8e-41	141.2
TkA02G611090	`PF13967`	RSN1_TM	6	168	1.3e-38	132.8
TkA02G611090	`PF14703`	PHM7_cyt	189	248	8.5e-20	72.4
TkA02G611090	`PF14703`	PHM7_cyt	275	324	8.5e-20	72.4
TkA02G611090	`PF02714`	RSN1_7TM	337	529	6.8e-41	141.2
TkA02G611090	`PF13967`	RSN1_TM	340	364	1.3e-38	132.8
TkA02G611090	`PF13967`	RSN1_TM	438	456	1.3e-38	132.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I248`	Arabidopsis thaliana	sp\|F4I248\|OSC24_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.4	53.200%	Swiss-Prot	High
`Q8GUH7`	Arabidopsis thaliana	sp\|Q8GUH7\|OSC23_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.3	49.300%	Swiss-Prot	Medium
`F4IBD7`	Arabidopsis thaliana	sp\|F4IBD7\|OSC21_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.1	37.700%	Swiss-Prot	Medium
`Q94A87`	Arabidopsis thaliana	sp\|Q94A87\|OSC22_ARATH Hyperosmolality-gated Ca2+ permeable channel 2.2	34.400%	Swiss-Prot	Medium
`F4HYR3`	Arabidopsis thaliana	sp\|F4HYR3\|OSC14_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.4	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card