TkA02G609080 | RubberDandelionOmics

Gene overview

TkA02G609080

Reference: TK1151 Chr: Chr02 Coordinates: 157083411-157085335 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1169 bp · TkA02G609080|TK1151|cDNA

ATAGCAAGTAAGTAGTATGCACCGCCTCTAGGTTTCGTCGTGGTTCCAATTCTTTTCGTCATCATCTCTGTCCCAATGAGCTGTCTCCTCTCTTTTCACACACACACACACGGGACCACCTGAACCCTAAAGCAAACTTCCTATTCCCGCTTCGAATCGCTTCCTTCATTTTCGTAATTTGCTTTCACCCATGATATGGGAGATGGAGATGGAACAGGTTGAAGCCGTTCTCGAGAAGATTTGGGACTTGCACGACAAGC...

CDS

Download CDS FASTA

774 bp · TkA02G609080|TK1151|CDS

ATGATATGGGAGATGGAGATGGAACAGGTTGAAGCCGTTCTCGAGAAGATTTGGGACTTGCACGACAAGCTTAGCGATGCTATTCACTCCATTTCTAGATCTCATTTTCTCCACTCCGTCAAAGCGTTACGCAATTCGAACGATCTATTCGAACGCGCGGCAGATAACAACAAGAAAGTCTCCGATGATGAAGTCAAAGGAGGTTTTGTTTACGTGAAAGGCTTTCCGATCGAAGAAGATGATGACTCCGCTATTCATGA...

Protein

Download Protein FASTA

257 aa · TkA02G609080|TK1151|PROTEIN

MIWEMEMEQVEAVLEKIWDLHDKLSDAIHSISRSHFLHSVKALRNSNDLFERAADNNKKVSDDEVKGGFVYVKGFPIEEDDDSAIHEAKSLNSIRTALENLEDQLEFFHTVQTQQRAERDAAIARLEQSRIVLALRLADHHGKKYKVIEEARAFVGQVQNHSYLEKRSNTLVKVVISSFNFAKKSLKVDHVGGVLGNAALFAVSMVALLHLHQVADRDRYISDLQQVNTSQLNKNVTKVYVPQGASSNGLDVLSARG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G609080`
TK1151 ID	TkA02G609080
OH-1004 ID	LXL04_011847
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G609080

Location Chr02:157083411-157085335 (-)

Description Similar to PDV1: Plastid division protein PDV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53280`	Component of the plastid division machinery.	PDV1 and PDV2 mediate recruitment of the dynamin-related protein ARC5 to the plastid division site.2006 · DOI: 10.1105/tpc.106.045484 Phosphatidylinositol 4-phosphate negatively regulates chloroplast division in Arabidopsis.2015 · DOI: 10.1105/tpc.115.136234 PDV1 and PDV2 Differentially Affect Remodeling and Assembly of the Chloroplast DRP5B Ring.2020 · DOI: 10.1104/pp.19.01490

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011847 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0009707 chloroplast outer membrane Cellular Component

GO:0070273 phosphatidylinositol-4-phosphate binding Molecular Function

KEGG gene cross-reference

ath:AT5G53280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.321

Rank 1 · TkA02G609080 · TK1151

Plastid0.182

Rank 2 · TkA02G609080 · TK1151

Cytoplasm0.178

Rank 3 · TkA02G609080 · TK1151

Nucleus0.176

Rank 4 · TkA02G609080 · TK1151

Endoplasmic reticulum0.116

Rank 5 · TkA02G609080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28116PDV_N6-129 aa

PF20978Gta383-112 aa

PF00359PTS_EIIA_287-177 aa

PF14738CFAP9198-152 aa

PF15786PET117110-121 aa

PF15786PET117194-219 aa

PF14738CFAP91205-234 aa

PF00359PTS_EIIA_2207-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G609080	`PF28116`	PDV_N	6	129	1.7e-34	118.9
TkA02G609080	`PF20978`	Gta3	83	112	0.092	13.4
TkA02G609080	`PF00359`	PTS_EIIA_2	87	177	0.1	13.2
TkA02G609080	`PF14738`	CFAP91	98	152	0.13	13.0
TkA02G609080	`PF15786`	PET117	110	121	0.079	13.8
TkA02G609080	`PF15786`	PET117	194	219	0.079	13.8
TkA02G609080	`PF14738`	CFAP91	205	234	0.13	13.0
TkA02G609080	`PF00359`	PTS_EIIA_2	207	227	0.1	13.2
TkA02G609080	`PF28116`	PDV_N	209	226	1.7e-34	118.9
TkA02G609080	`PF20978`	Gta3	221	233	0.092	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK13`	Arabidopsis thaliana	sp\|Q9FK13\|PDV1_ARATH Plastid division protein PDV1	50.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card