RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G607900
Reference: TK1151 Chr: Chr02 Coordinates: 156814832-156821457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4951 bp · TkA02G607900|TK1151|cDNA

TAGACGTTTTGCTGCTTATACTATTATAGGCTGACGATGATATATTTCTTTATTGTTATTGTCTTTTGGCGTAAACATGTCGTTTATGATCGTCTTTTCTTCCTCTGACGACATCACCTGTCTATTCGCACCGATCAAAAGGAGGATTTCTATAACTTCTTAGGAAAAAGAGAAGTAAGAAAGAAAGAAATCAAGAGGATCAAGAAAGAAACCCTTTGGGAGTGTTGTTGCTACCCCTTTGCCAGTATTAAGAATTAGGA...

CDS

Download CDS FASTA

3702 bp · TkA02G607900|TK1151|CDS

ATGGCTAATCTATGGAGTTCCTTTTGCGGGTGTTCCAGCAATGACAAAAATTGTGATCAAGATTTGATTTTTATCACAAATCCTTCTTCGTGTATGAATCATGTTCTACTCATTTGTTTCGATTTATTACTCCTCGCCATGTTACTCCTCTCCATTCTTTACAAATCACCATCAAAATACACCCAAAGATCATCTCTTTTTCACCGGAAATCACGTTTACAGTTAATTTCGGCAATCTTTAACAGTTTACTGGGAACACT...

Protein

Download Protein FASTA

1233 aa · TkA02G607900|TK1151|PROTEIN

MANLWSSFCGCSSNDKNCDQDLIFITNPSSCMNHVLLICFDLLLLAMLLLSILYKSPSKYTQRSSLFHRKSRLQLISAIFNSLLGTLYICLGIWTLKTTILPLHQWITFLFHGVTWLTVSLTVSLTGKHFPKTPVRLLSIASVLFTGFFGALSILNNSMSIKVAMDTTSFLGSLLLLACTYKGFNYEEINNNNNCLYTPLTNGIKENYQENLTPLANAGFLNVMSFWWLNPLMKTGSQKTLEEKDMPKLRTQDRAEFCYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G607900
TK1151 IDTkA02G607900
OH-1004 IDLXL04_011854
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 99.513 / OH-1004 84.099
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G607900
LocationChr02:156814832-156821457 (-)
DescriptionSimilar to ABCC10: ABC transporter C family member 10
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g59140 Pump for glutathione S-conjugates. No verified direct reference in this release
At3g21250 Pump for glutathione S-conjugates. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XCD4 ABC transporter that may affect phytic acid transport and compartmentalization. No verified direct reference in this release
Os03g0142800 ABC transporter that may affect phytic acid transport and compartmentalization.
Mutations of the multi-drug resistance-associated protein ABC transporter gene 5 result in reduction of phytic acid in rice seeds.2009 · DOI: 10.1007/s00122-009-1018-1
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011854 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0055085 transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0005524 ATP binding Molecular Function
GO:0008559 ABC-type xenobiotic transporter activity Molecular Function
GO:0016887 ATP hydrolysis activity Molecular Function
GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function
GO:0140359 ABC-type transporter activity Molecular Function
KEGG gene cross-reference
ath:AT3G21250
ath:AT3G59140
dosa:Os03g0142800
zma:100125659
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.423
Rank 1 · TkA02G607900 · TK1151
Lysosome / Vacuole0.282
Rank 2 · TkA02G607900 · TK1151
Endoplasmic reticulum0.151
Rank 3 · TkA02G607900 · TK1151
Cytoplasm0.133
Rank 4 · TkA02G607900 · TK1151
Golgi apparatus0.079
Rank 5 · TkA02G607900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24358ABCC10_N1-186 aa
PF00931NB-ARC95-124 aa
PF00664ABC_membrane136-170 aa
PF00664ABC_membrane288-556 aa
PF00005ABC_tran622-756 aa
PF13555AAA_29633-649 aa
PF00931NB-ARC634-688 aa
PF02463SMC_N635-653 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G607900PF24358ABCC10_N11863.2e-61207.0
TkA02G607900PF00931NB-ARC951240.08613.1
TkA02G607900PF00664ABC_membrane1361704.2e-45155.3
TkA02G607900PF00664ABC_membrane2885564.2e-45155.3
TkA02G607900PF00005ABC_tran6227564.3e-2073.4
TkA02G607900PF13555AAA_296336490.04914.1
TkA02G607900PF00931NB-ARC6346880.08613.1
TkA02G607900PF02463SMC_N6356530.01815.2
TkA02G607900PF13304AAA_216366520.002818.4
TkA02G607900PF02463SMC_N6917960.01815.2
TkA02G607900PF13304AAA_217287870.002818.4
TkA02G607900PF00664ABC_membrane89811484.2e-45155.3
TkA02G607900PF24358ABCC10_N9139513.2e-61207.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LYS2Arabidopsis thalianasp|Q9LYS2|AB10C_ARATH ABC transporter C family member 1061.000%Swiss-ProtHigh
Q8LGU1Arabidopsis thalianasp|Q8LGU1|AB8C_ARATH ABC transporter C family member 839.600%Swiss-ProtMedium
A2XCD4Oryza sativa subsp. indicasp|A2XCD4|AB13C_ORYSI ABC transporter C family member 1341.900%Swiss-ProtMedium
Q10RX7Oryza sativa subsp. japonicasp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 1341.900%Swiss-ProtMedium

JBrowse

View in Genome Browser