TkA02G606500 | RubberDandelionOmics

Gene overview

TkA02G606500

Reference: TK1151 Chr: Chr02 Coordinates: 156474677-156479829 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3310 bp · TkA02G606500|TK1151|cDNA

TTGAAGTCTGTTTGATTTTGTTTTCTACTTTGATGAATATATAGATTTTTAGTATCGACAATAGCAAAATAAGTCATAGAGAGATGTCCTGCGAACTAACACTATTTTCATGTGTACCACAATGGTCCACCGTCTTTAAGTCTCTTTAATGCGCTAACTATATTCATGTTTTTTTTTTTTTTTTGCAATAAGTTAATACCATCTAACACACAAACACATACGCCAAAAAGATATGGAATCTGCGACGGTGGTTCTGTATC...

CDS

Download CDS FASTA

1416 bp · TkA02G606500|TK1151|CDS

ATGGAATCTGCGACGGTGGTTCTGTATCCATCTCCGGGAATAGGCCACCTGGTTTCCATGGTGGAGCTCGGAAAGCTCATCCGCACCCACCACCCTTCCCTGTCTCTCATCATCCTCATAACTCCCGCACCTTTCGAAACCGGCTCCACCGATAAATATATCAAAACCGTCTCTGCCACCACCCCTGCCATCACCTTCCACCACTTCCCCACCGTCGCTATTCCACCGGACTTATTTTCTAATTTCGTGGGACTTAGTTT...

Protein

Download Protein FASTA

471 aa · TkA02G606500|TK1151|PROTEIN

MESATVVLYPSPGIGHLVSMVELGKLIRTHHPSLSLIILITPAPFETGSTDKYIKTVSATTPAITFHHFPTVAIPPDLFSNFVGLSFAIPQLHNPTFHNTLVSISEKSTIKAVILDFFTNAAFQVSKSLELPTYYFYTGGASGLCVFLHLPTTDTIASDSIKDQNVYFDIPGVPPIHSSNFPAAMSDKRSITYKNFLSTSKNMAKSSGIIANTFVGFEERAVGTLRDGKCITDGPTPPTYFIGPLIAGGNQVDPSENECL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G606500`
TK1151 ID	TkA02G606500
OH-1004 ID	LXL04_011870
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 82.343 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G606500

Location Chr02:156474677-156479829 (-)

Description Similar to UGT88B1: UDP-glycosyltransferase 88B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16520`	Possesses low quercetin 3-O-glucosyltransferase, 7-O-glucosyltransferase, 3'-O-glucosyltransferase and 4'-O-glucosyltransferase activities in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011870 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0050004 isoflavone 7-O-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

GO:0080045 quercetin 3'-O-glucosyltransferase activity Molecular Function

GO:0080046 quercetin 4'-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAD99560

ath:AT3G16520

gmx:100101902

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.810

Rank 1 · TkA02G606500 · TK1151

Nucleus0.241

Rank 2 · TkA02G606500 · TK1151

Endoplasmic reticulum0.072

Rank 3 · TkA02G606500 · TK1151

Peroxisome0.048

Rank 4 · TkA02G606500 · TK1151

Cell membrane0.045

Rank 5 · TkA02G606500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT100-137 aa

PF00201UDPGT250-431 aa

PF07249Cerato-platanin340-371 aa

PF04101Glyco_tran_28_C363-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G606500	`PF00201`	UDPGT	100	137	5.8e-26	92.1
TkA02G606500	`PF00201`	UDPGT	250	431	5.8e-26	92.1
TkA02G606500	`PF07249`	Cerato-platanin	340	371	0.027	15.3
TkA02G606500	`PF04101`	Glyco_tran_28_C	363	432	0.016	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK73`	Arabidopsis thaliana	sp\|Q9LK73\|U88A1_ARATH UDP-glycosyltransferase 88A1	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card