TkA02G604980 | RubberDandelionOmics

Gene overview

TkA02G604980

Reference: TK1151 Chr: Chr02 Coordinates: 156031756-156040558 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1969 bp · TkA02G604980|TK1151|cDNA

CATGGGCCCGCCCCCACTCACCCATCCATCTCCTGTGGGCCCCCTCTCTATTTGGTGGGCCCTCCCTTATCAGTCAACTATTCCCGTCACTCTTCCCTCCCCGCCCATCTCCCACATTCGAAACCGATACCTTCGTCTTCATTCTCCATCTCTCCCTCTATCTCTGTAAATTGATTCCTCGTCCTTATCATCTTCCTTCTTGTCTTCTTCTCTCTCATAAATCATTGAAGATTCTTATAATTCATATGCATATATACGAT...

CDS

Download CDS FASTA

1215 bp · TkA02G604980|TK1151|CDS

ATGGAGCTGGTTTTCGCGATTGTGTTAGTCGTCATCGTCCTGCTAACATGTGCCGGAACGTCTGTCTCTTCCGACGATCGTCTTTTGGTGAACATGACGGTGGTTCGCAGCGCTGCGGCGGCCGGAGCTTATTGCTTGGACGGTAGTTTGCCTGCGTATCATATACACAGAGGATTCGGCGCCGGAGCACGCAACTGGCTTTTGCAATTTGAGGGTGGTGGGTGGTGTAATGATATCGAATCATGTGCAGAGAGAGCTAA...

Protein

Download Protein FASTA

404 aa · TkA02G604980|TK1151|PROTEIN

MELVFAIVLVVIVLLTCAGTSVSSDDRLLVNMTVVRSAAAAGAYCLDGSLPAYHIHRGFGAGARNWLLQFEGGGWCNDIESCAERAKTRRGSTTLMNKLETFSGILSDDPFRNPDFYNWNRVKLRYCDGGSFAGDAKFDNGTLVLFFRGQRIWQAIIKDLLPKGLRFANKALLSGCSAGGLAAYLHCNNFTTYLPDTTTVKCLGDAGFFLDSPDITMNHTQRSFFQHLVTLQGIEQNLDENCTTSLSDPKQCIFPQYLLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G604980`
TK1151 ID	TkA02G604980
OH-1004 ID	LXL04_011902
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G604980

Location Chr02:156031756-156040558 (+)

Description Similar to PAE9: Pectin acetylesterase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23870`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	Identification and functional characterization of the distinct plant pectin esterases PAE8 and PAE9 and their deletion mutants.2014 · DOI: 10.1007/s00425-014-2139-6
`At2g46930`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At1g57590`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At3g62060`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At5g26670`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011902 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009625 response to insect Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0052793 pectin acetylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G57590

ath:AT2G46930

ath:AT3G62060

ath:AT5G23870

ath:AT5G26670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.507

Rank 1 · TkA02G604980 · TK1151

Extracellular0.277

Rank 2 · TkA02G604980 · TK1151

Cytoplasm0.124

Rank 3 · TkA02G604980 · TK1151

Cell membrane0.091

Rank 4 · TkA02G604980 · TK1151

Endoplasmic reticulum0.085

Rank 5 · TkA02G604980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03283PAE26-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G604980	`PF03283`	PAE	26	392	1e-159	532.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DFR3`	Arabidopsis thaliana	sp\|B9DFR3\|PAE9_ARATH Pectin acetylesterase 9	62.400%	Swiss-Prot	High
`O80731`	Arabidopsis thaliana	sp\|O80731\|PAE3_ARATH Pectin acetylesterase 3	53.100%	Swiss-Prot	High
`F4I839`	Arabidopsis thaliana	sp\|F4I839\|PAE2_ARATH Pectin acetylesterase 2	53.700%	Swiss-Prot	High
`Q84JS1`	Arabidopsis thaliana	sp\|Q84JS1\|PAE6_ARATH Pectin acetylesterase 6	53.300%	Swiss-Prot	High
`Q66GM8`	Arabidopsis thaliana	sp\|Q66GM8\|PAE10_ARATH Pectin acetylesterase 10	52.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card