Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1712 bp · TkA02G604850|TK1151|cDNA
GAGCCGCCAGCCCTCTACTCCCTGTTAACCTTCGATGGACACGTGCACAACACGTTAAAACGATCATTACCAACCAAAAATTAGAAGAAAAATAAAGAACGAAACCCTAGGTCGAGATTTCGACCTCCATTTTCACTTCAGACGATTTAGCTATTCCACAAAACTAAAAATAGCCTCAATATTCTCTTCGTCTCTACGTCAGGCTGAGAATTCATCTTTGAAGGCATAAAGTTGTAATAGTTTTTAGGCTTTCCCTTCTT...
960 bp · TkA02G604850|TK1151|CDS
ATGGCTATCGTTAAACCAGAGTCATTCATCTGGCTACAAACACCTGATGGATCAATTCAACAAGTGGAGGAAGAAGTTGCAATGTTTTGTCCAATGATATGTCGGGAGGTTCTTCAAACAGGAATGGGGTCCTCAAAAAACTATGCTATAAAACTCCCTCAAAGAGTCAGTACACCTGTCTTGGGTTTAATCCTTGACTATTGTCGCTTTCATCAAGTTCAAGGGAGATCCAATAAGGAGAGGAAAACATTTGATGAAAA...
Protein
Download Protein FASTA319 aa · TkA02G604850|TK1151|PROTEIN
MAIVKPESFIWLQTPDGSIQQVEEEVAMFCPMICREVLQTGMGSSKNYAIKLPQRVSTPVLGLILDYCRFHQVQGRSNKERKTFDEKLIRLDIKKLCELTSGADSLQLRPLVDLTSRALARMIEGKTPEEIRETFHLPDDLTEEEKLEPLRIRTHDPRIRLLNRLYARKRQELKLRQNSKCMVENVEIEEERVDDRSVDDLLLFINSGDEDSKPSTAKNKKKNRRRKDHSKGHKKETDDLCSSPSKISKLVESGSPMHSS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G604850 |
|---|---|
| TK1151 ID | TkA02G604850 |
| OH-1004 ID | LXL04_011908 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G604850 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:155991868-155995227 (+) | |||||||||
| Description | Similar to ASK21: SKP1-like protein 21 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000018 regulation of DNA recombination Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0000712 resolution of meiotic recombination intermediates Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0045841 negative regulation of mitotic metaphase/anaphase transition Biological Process GO:0101026 mitotic nuclear membrane biogenesis Biological Process GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G45950 ath:AT3G61415 ddi:DDB_G0269230 ddi:DDB_G0273251 ddi:DDB_G0273615 ncr:NCU08991 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03931Skp1_POZ9-72 aaPF08183SpoV46-53 aaPF01466Skp1110-146 aaPF03931Skp1_POZ116-125 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G604850 | PF03931 | Skp1_POZ | 9 | 72 | 3.2e-05 | 24.7 |
| TkA02G604850 | PF08183 | SpoV | 46 | 53 | 0.37 | 11.6 |
| TkA02G604850 | PF01466 | Skp1 | 110 | 146 | 1.2e-13 | 51.4 |
| TkA02G604850 | PF03931 | Skp1_POZ | 116 | 125 | 3.2e-05 | 24.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.