TkA02G600500 | RubberDandelionOmics

Gene overview

TkA02G600500

Reference: TK1151 Chr: Chr02 Coordinates: 154835145-154837000 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · TkA02G600500|TK1151|cDNA

ATGCCAGTGCCGCCCCTGTGCATGGCTAACCGTCGCCGCAATTCCTCCGCTTTTCAGCTTCCTCAAAATGTTACCTCTCAATCCACCACCACCGACGCAGCTGGTGGGTCTTCTGGCCGCCACTCAGTTTACCATGGCATCCGAATGCGAGCTGGAAAATGGGTTTCTGAAATACGTGAAGCAAACAAGTCCAGTCGCATATGGCTTGGTTCTTATCCAACACCGGAGATGGCAGCTGCCGCCTACGACGTCGCTGCATT...

CDS

Download CDS FASTA

1281 bp · TkA02G600500|TK1151|CDS

ATGCCAGTGCCGCCCCTGTGCATGGCTAACCGTCGCCGCAATTCCTCCGCTTTTCAGCTTCCTCAAAATGTTACCTCTCAATCCACCACCACCGACGCAGCTGGTGGGTCTTCTGGCCGCCACTCAGTTTACCATGGCATCCGAATGCGAGCTGGAAAATGGGTTTCTGAAATACGTGAAGCAAACAAGTCCAGTCGCATATGGCTTGGTTCTTATCCAACACCGGAGATGGCAGCTGCCGCCTACGACGTCGCTGCATT...

Protein

Download Protein FASTA

426 aa · TkA02G600500|TK1151|PROTEIN

MPVPPLCMANRRRNSSAFQLPQNVTSQSTTTDAAGGSSGRHSVYHGIRMRAGKWVSEIREANKSSRIWLGSYPTPEMAAAAYDVAALAVKGMYAVLNFSDSAISNTLPDCPTADDIRAAAARAAASRSSTYEYGGGSMTMVGPHGLCLLLVNIQRGKSSIFLQPIDGEEMKLDLAICTRHEKHDTNTTRVFRVRVWEIRVFVSDTDKTRKNSLSRFLSSLSAFFFRFFSRFLSSHRRQPRFLPVFYLSASRYHLHEEEHR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G600500`
TK1151 ID	TkA02G600500
OH-1004 ID	LXL04_024952
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 48.122 / OH-1004 58.640 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G600500

Location Chr02:154835145-154837000 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52020`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g63040`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g12630`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g11590`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g25810`	Putative transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024952 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.573

Rank 1 · TkA02G600500 · TK1151

Cytoplasm0.348

Rank 2 · TkA02G600500 · TK1151

Cell membrane0.121

Rank 3 · TkA02G600500 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA02G600500 · TK1151

Plastid0.039

Rank 5 · TkA02G600500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07585BBP74-69 aa

PF00847AP243-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G600500	`PF07585`	BBP7	4	69	0.19	11.6
TkA02G600500	`PF00847`	AP2	43	91	1.1e-09	39.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ90`	Arabidopsis thaliana	sp\|Q9FJ90\|ERF25_ARATH Ethylene-responsive transcription factor ERF025	65.900%	Swiss-Prot	Low
`Q9CAN9`	Arabidopsis thaliana	sp\|Q9CAN9\|ERF26_ARATH Ethylene-responsive transcription factor ERF026	62.200%	Swiss-Prot	Low
`Q38Q39`	Arabidopsis thaliana	sp\|Q38Q39\|ERF27_ARATH Ethylene-responsive transcription factor ERF027	59.800%	Swiss-Prot	Low
`Q9LYD3`	Arabidopsis thaliana	sp\|Q9LYD3\|DREB3_ARATH Dehydration-responsive element-binding protein 3	54.300%	Swiss-Prot	Low
`Q39127`	Arabidopsis thaliana	sp\|Q39127\|TINY_ARATH Ethylene-responsive transcription factor TINY	53.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card