TkA02G593840 | RubberDandelionOmics

Gene overview

TkA02G593840

Reference: TK1151 Chr: Chr02 Coordinates: 153177406-153181922 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1372 bp · TkA02G593840|TK1151|cDNA

TTAACTTCTAGGCTGTGGATAATGTCAACTCAATAATCGGACCTGCCTTGATTGGCAAGGATCCTTCAGAACAGACCAAAATTGACAACTTCATGGTTCAAGAACTCGATGGAACAGTAAATGAGTGGGGTTGGTGCAAACAGAAGCTTGGTGCAAATGCAATACTGGCAGTCTCATTAGCTGTGTGTAAAGCAGGAGCTTCAGTTAAAAAAATCCCTCTCTATAAGCACATTGCAAACCTTGCTGGAAATAAGACCCTG...

CDS

Download CDS FASTA

1059 bp · TkA02G593840|TK1151|CDS

ATGGCAACTATCAAGGCCGTGAAAGCTCGTCAGATATTCGACAGCCGCGGTAATCCTACAGTCGAAGTCGATGTTACACTTTCTGATGGAACATTGGCAAGAGCTGCAGTACCTAGCGGTGCTTCAACAGGTGTATACGAAGCCCTAGAATTAAGAGATGGAGGTTCTGACTACCTCGGAAAAGGTGTCCTGAAGGCTGTGGATAATGTCAACTCAATAATCGGACCTGCCTTGATTGGCAAGGATCCTTCAGAACAGAC...

Protein

Download Protein FASTA

352 aa · TkA02G593840|TK1151|PROTEIN

MATIKAVKARQIFDSRGNPTVEVDVTLSDGTLARAAVPSGASTGVYEALELRDGGSDYLGKGVLKAVDNVNSIIGPALIGKDPSEQTKIDNFMVQELDGTVNEWGWCKQKLGANAILAVSLAVCKAGASVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKTGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKSGYTGKVVIGMDVAASEFYENK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G593840`
TK1151 ID	TkA02G593840
OH-1004 ID	LXL04_012006
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 96.875 / OH-1004 76.629 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G593840

Location Chr02:153177406-153181922 (-)

Description Similar to ENO1: Enolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0167300`	Enolase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012006 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

dosa:Os10g0167300

rcu:8288376

zma:542316

zma:732811

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · TkA02G593840 · TK1151

Nucleus0.212

Rank 2 · TkA02G593840 · TK1151

Mitochondrion0.172

Rank 3 · TkA02G593840 · TK1151

Cell membrane0.101

Rank 4 · TkA02G593840 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA02G593840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952Enolase_N4-139 aa

PF00113Enolase_C148-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G593840	`PF03952`	Enolase_N	4	139	4.2e-54	183.0
TkA02G593840	`PF00113`	Enolase_C	148	346	3.4e-96	322.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42971`	Oryza sativa subsp. japonica	sp\|Q42971\|ENO_ORYSJ Enolase	88.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card