Gene Card
Gene overview
cDNA / CDS / Protein Sequences
579 bp · TkA02G590340|TK1151|cDNA
ATGTATCGTTGGAGTCATAAATCAGTCAAGGAAAGCAAATCCCAGAAAAACACACAAAACCCATCCTTTTCCTCAACCCTTCTCGATGAAATCTACCGTTCCATGGACGGGGACGACGAGAAATTAAGCCAAGAAGAGAAATTCCCAAAGAAACAGACCACCGCCAGCGGCGGTGGCAGACCAAAGGCGAGCAGTGCGGTGGAGGACGAAGGAGTGGCGAGTCTCCGGCGAGCTTTTCTGGTCGAGAAATGGATGGATAT...
579 bp · TkA02G590340|TK1151|CDS
ATGTATCGTTGGAGTCATAAATCAGTCAAGGAAAGCAAATCCCAGAAAAACACACAAAACCCATCCTTTTCCTCAACCCTTCTCGATGAAATCTACCGTTCCATGGACGGGGACGACGAGAAATTAAGCCAAGAAGAGAAATTCCCAAAGAAACAGACCACCGCCAGCGGCGGTGGCAGACCAAAGGCGAGCAGTGCGGTGGAGGACGAAGGAGTGGCGAGTCTCCGGCGAGCTTTTCTGGTCGAGAAATGGATGGATAT...
Protein
Download Protein FASTA192 aa · TkA02G590340|TK1151|PROTEIN
MYRWSHKSVKESKSQKNTQNPSFSSTLLDEIYRSMDGDDEKLSQEEKFPKKQTTASGGGRPKASSAVEDEGVASLRRAFLVEKWMDMKPINSKNKTHRTKPSSLPDFDQKPVLDNDQFFISSGTSSSDSSYGWFSKPKGFHNSRCHKSSCFGPFRRPEPVKTNAFSKKHQQMELCYCSDDHQMEFMVAILHD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G590340 |
|---|---|
| TK1151 ID | TkA02G590340 |
| OH-1004 ID | LXL04_019117 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 91.800 |
| Protein coverage (%) | TK1151 94.792 / OH-1004 49.322Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G590340 |
|---|---|
| Location | Chr02:152341173-152341751 (-) |
| Description | Similar to At1g54200: Protein BIG GRAIN 1-like B |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009630 gravitropism Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process GO:0060918 auxin transport Biological Process GO:0080113 regulation of seed growth Biological Process GO:0005634 nucleus Cellular Component GO:0005886 plasma membrane Cellular Component |
| KEGG gene cross-reference | ath:AT1G54200 ath:AT3G13980 ath:AT3G42800 dosa:Os03g0175800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30505Big_grain_11-43 aaPF30505Big_grain_1122-136 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G590340 | PF30505 | Big_grain_1 | 1 | 43 | 5.5e-06 | 27.0 |
| TkA02G590340 | PF30505 | Big_grain_1 | 122 | 136 | 5.5e-06 | 27.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.