Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1341 bp · TkA02G590080|TK1151|cDNA
GGGAAAAGTGGAAAGCCATCGAATTTTCCGTCTCCAAGCTTCCTTTTGGAGCAAGTTTTTGTACAGTTTACAGTCTCTATTCCTATCTAAAGCTTCTATCTTATCTAAAAAGGTGTATAGATTCAATTCCACCGCTGGATATCGCAGCCCTTCAGATTTCATCAGCATAACTGATAACTCAAATTATGGTAAAAGCCATTAGGGTTTATGAGCTTGGTGGCCCTGAGGTACTAAAATGGGAAGATATCGAAGTTGGGGAT...
990 bp · TkA02G590080|TK1151|CDS
ATGGTAAAAGCCATTAGGGTTTATGAGCTTGGTGGCCCTGAGGTACTAAAATGGGAAGATATCGAAGTTGGGGATCCTAAAGAGGGAGAGATTAGAGTGAAGAACAAAGCCATCGGCGTTAACTTCATTGATATATATTACCGGACCGGAGTTTATAAGGTCCCTGAAATTCCATATATACCAGGAGCGGAGGCAGCAGGTGTGGTGACAGCCGTGGGATCAGGAGTAAACAATCTGAAAATTGGAGATGTTGTTTATCA...
Protein
Download Protein FASTA329 aa · TkA02G590080|TK1151|PROTEIN
MVKAIRVYELGGPEVLKWEDIEVGDPKEGEIRVKNKAIGVNFIDIYYRTGVYKVPEIPYIPGAEAAGVVTAVGSGVNNLKIGDVVYHSGSPMGTYMEEQIISAEKAIPLPPSVDPLVAASAMVKGLTARFLVRTWFKVEQGHTVLVHAAAGGVGSLLCQWANILGAIVIGTVSTKEKALQAKEDGCHHVIIYKEEDFVTRVNEITSGQGVEVVFDSVGKDTFEGSLACLKPRGYLMSYGQSSGTPDPVPLSALAAKSLFL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G590080 |
|---|---|
| TK1151 ID | TkA02G590080 |
| OH-1004 ID | LXL04_012056 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.100 |
| Protein coverage (%) | TK1151 96.049 / OH-1004 26.985Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G590080 |
|---|---|
| Location | Chr02:152261578-152263336 (+) |
| Description | Similar to PCMP-H41: Pentatricopeptide repeat-containing protein At2g22070 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009451 RNA modification Biological Process GO:0010214 seed coat development Biological Process GO:0140547 acquisition of seed longevity Biological Process GO:0005739 mitochondrion Cellular Component GO:0003723 RNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G25360 ath:AT1G68930 ath:AT2G22070 ath:AT4G02750 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16884ADH_N_215-89 aaPF08240ADH_N28-110 aaPF00107ADH_zinc_N67-96 aaPF00107ADH_zinc_N152-280 aaPF08240ADH_N161-173 aaPF02225PA162-202 aaPF13602ADH_zinc_N_2185-322 aaPF16884ADH_N_2266-297 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G590080 | PF16884 | ADH_N_2 | 15 | 89 | 0.0075 | 16.9 |
| TkA02G590080 | PF08240 | ADH_N | 28 | 110 | 6.1e-15 | 56.1 |
| TkA02G590080 | PF00107 | ADH_zinc_N | 67 | 96 | 5.7e-25 | 88.5 |
| TkA02G590080 | PF00107 | ADH_zinc_N | 152 | 280 | 5.7e-25 | 88.5 |
| TkA02G590080 | PF08240 | ADH_N | 161 | 173 | 6.1e-15 | 56.1 |
| TkA02G590080 | PF02225 | PA | 162 | 202 | 0.027 | 15.3 |
| TkA02G590080 | PF13602 | ADH_zinc_N_2 | 185 | 322 | 3.9e-22 | 80.3 |
| TkA02G590080 | PF16884 | ADH_N_2 | 266 | 297 | 0.0075 | 16.9 |
| TkA02G590080 | PF02225 | PA | 310 | 326 | 0.027 | 15.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.