TkA02G589300 | RubberDandelionOmics

Gene overview

TkA02G589300

Reference: TK1151 Chr: Chr02 Coordinates: 152080978-152081743 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

594 bp · TkA02G589300|TK1151|cDNA

ATGGAAATTGCTTCATGGTGCCTCAGAGCTATCCTCTGTAAAGACTGCGATGTTGCGATTCATAAAATCAACCAACACACACAAAATCTCAACCGGTTTCTACTCACCGGCGTTAAGCTATCTCCGACTGCTTCTCTTTATTCCTCATCAACAACAATAACTCCTCCGGTGGCCTCACCGGTTACAAAAAACGCCGTCGTTCCCGACCAATATGCGGAACTACTTCCCTCTCCGATCACGAACCAGAGTTCTCTGAAAAC...

CDS

Download CDS FASTA

594 bp · TkA02G589300|TK1151|CDS

ATGGAAATTGCTTCATGGTGCCTCAGAGCTATCCTCTGTAAAGACTGCGATGTTGCGATTCATAAAATCAACCAACACACACAAAATCTCAACCGGTTTCTACTCACCGGCGTTAAGCTATCTCCGACTGCTTCTCTTTATTCCTCATCAACAACAATAACTCCTCCGGTGGCCTCACCGGTTACAAAAAACGCCGTCGTTCCCGACCAATATGCGGAACTACTTCCCTCTCCGATCACGAACCAGAGTTCTCTGAAAAC...

Protein

Download Protein FASTA

197 aa · TkA02G589300|TK1151|PROTEIN

MEIASWCLRAILCKDCDVAIHKINQHTQNLNRFLLTGVKLSPTASLYSSSTTITPPVASPVTKNAVVPDQYAELLPSPITNQSSLKTSNCYQESNGSGNGSTTSSISGIKRVSPFSTESMGMWVPQAPPPAAPPPPPPSRYTHAVQQFEPSSMMGFGDQTINGSSLAVENERGGSPIGEEGLNNAYSIKSDFDLVNI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G589300`
TK1151 ID	TkA02G589300
OH-1004 ID	LXL04_030521
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.000
Protein coverage (%)	TK1151 80.203 / OH-1004 60.443 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G589300

Location Chr02:152080978-152081743 (+)

Description Similar to BBX21: B-box zinc finger protein 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75540`	Transcription activator that acts as a positive regulator of seedling photomorphogenesis.	SALT TOLERANCE HOMOLOG2, a B-box protein in Arabidopsis that activates transcription and positively regulates light-mediated development.2007 · DOI: 10.1105/tpc.107.054791

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030521 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0010100 negative regulation of photomorphogenesis Biological Process

GO:0010117 photoprotection Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G06040

ath:AT1G75540

ath:AT1G78600

ath:AT2G31380

ath:AT4G39070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · TkA02G589300 · TK1151

Cytoplasm0.229

Rank 2 · TkA02G589300 · TK1151

Cell membrane0.041

Rank 3 · TkA02G589300 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA02G589300 · TK1151

Lysosome / Vacuole0.019

Rank 5 · TkA02G589300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQZ7`	Arabidopsis thaliana	sp\|Q9LQZ7\|BBX21_ARATH B-box zinc finger protein 21	69.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card