TkA02G588060 | RubberDandelionOmics

Gene overview

TkA02G588060

Reference: TK1151 Chr: Chr02 Coordinates: 151753103-151754009 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

793 bp · TkA02G588060|TK1151|cDNA

CACACAGTAACGTGGTGTTATGTGTGTGTGTCTAAACCTCCTTCATCAATGGCGGATCTCGTAATGCCCAAGTTGATAAACCTGCTATCGTTTCTTCTCCAGAGAGCGGCGGAATCCAACGATCTGAACCGTCCGTTACACACTCAGAAGATATCCATCTTCTACGGATTGATCCGACCGAATATAAGCATCCAGAAGTATCTCGAGCGGATCTTCAGATACGCCAATTGCAGTCCTTCGTGCTATGTAGTGGCGTACGT...

CDS

Download CDS FASTA

600 bp · TkA02G588060|TK1151|CDS

ATGGCGGATCTCGTAATGCCCAAGTTGATAAACCTGCTATCGTTTCTTCTCCAGAGAGCGGCGGAATCCAACGATCTGAACCGTCCGTTACACACTCAGAAGATATCCATCTTCTACGGATTGATCCGACCGAATATAAGCATCCAGAAGTATCTCGAGCGGATCTTCAGATACGCCAATTGCAGTCCTTCGTGCTATGTAGTGGCGTACGTTTATCTCGATCGGTTCGTGAAGAATCAGCCGTTTTTGCCGATTAACTC...

Protein

Download Protein FASTA

199 aa · TkA02G588060|TK1151|PROTEIN

MADLVMPKLINLLSFLLQRAAESNDLNRPLHTQKISIFYGLIRPNISIQKYLERIFRYANCSPSCYVVAYVYLDRFVKNQPFLPINSFNVHRLLVTSVLISIKFMDDICFNNAYYAKVGGISTAEINLLEVDFLFGLGFQLNVTPETFREYCTYLQTEMMIGSPPVCSVPPVVTISADHCAIINEDDCQSQHHQPQLAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G588060`
TK1151 ID	TkA02G588060
OH-1004 ID	LXL04_010565
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.200
Protein coverage (%)	TK1151 83.417 / OH-1004 85.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G588060

Location Chr02:151753103-151754009 (+)

Description Similar to CYCU4-1: Cyclin-U4-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44740`	Cyclin-U4-1.	No verified direct reference in this release
`At5g61650`	Cyclin-U4-3.	No verified direct reference in this release
`At5g07450`	Cyclin-U4-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0563900`	Cyclin-P4-1.	No verified direct reference in this release
`Os05g0398000`	Cyclin-P3-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010565 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G44740

ath:AT5G07450

ath:AT5G61650

dosa:Os05g0398000

dosa:Os10g0563900

osa:4338711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.672

Rank 1 · TkA02G588060 · TK1151

Cytoplasm0.436

Rank 2 · TkA02G588060 · TK1151

Mitochondrion0.052

Rank 3 · TkA02G588060 · TK1151

Cell membrane0.024

Rank 4 · TkA02G588060 · TK1151

Plastid0.018

Rank 5 · TkA02G588060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07531TAFH8-70 aa

PF08613Cyclin25-141 aa

PF00134Cyclin_N48-142 aa

PF07531TAFH142-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G588060	`PF07531`	TAFH	8	70	0.14	12.9
TkA02G588060	`PF08613`	Cyclin	25	141	1.9e-41	142.7
TkA02G588060	`PF00134`	Cyclin_N	48	142	5.5e-09	36.5
TkA02G588060	`PF07531`	TAFH	142	163	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80513`	Arabidopsis thaliana	sp\|O80513\|CCU41_ARATH Cyclin-U4-1	62.100%	Swiss-Prot	High
`Q9FKF6`	Arabidopsis thaliana	sp\|Q9FKF6\|CCU43_ARATH Cyclin-U4-3	55.000%	Swiss-Prot	High
`Q9LY16`	Arabidopsis thaliana	sp\|Q9LY16\|CCU42_ARATH Cyclin-U4-2	62.300%	Swiss-Prot	High
`Q7XC35`	Oryza sativa subsp. japonica	sp\|Q7XC35\|CCP41_ORYSJ Cyclin-P4-1	55.400%	Swiss-Prot	High
`Q75HV0`	Oryza sativa subsp. japonica	sp\|Q75HV0\|CCP31_ORYSJ Cyclin-P3-1	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card