TkA02G587840 | RubberDandelionOmics

Gene overview

TkA02G587840

Reference: TK1151 Chr: Chr02 Coordinates: 151698249-151702413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3701 bp · TkA02G587840|TK1151|cDNA

TCACAATCAACCCTCAACACTTTTATTTGATGAAATCTTTCACGCTTTTTTGGCTTCTAACAGTTTTGGCATTATATACCAATCACTTGTGTTATGGTAATTTGTGCTTTGAGAACGAGAGATTAGCGCTTTTGCAGTTTAAGCATGACCTCATAGACGATGGCAACCGCCTCTCTTCTTGGAACAGTAGAAACACGGACTGTTGTCAATGGGCAGGAATCGTCTGTGACAACATTACAGGCCATGTCCAAGAGCTTCAT...

CDS

Download CDS FASTA

2538 bp · TkA02G587840|TK1151|CDS

ATGTCTGGATACGATCTTCACATTGCGTCTGAATGGCTTCAGGTGGTCCACACTCTTCCAGCACTGGAGGAATTGCACTTATCGTCATGTAATCTTTCTCAAATCCCTCGTCACCCAACCGTCGTTAATTTCACTTCACTTACCATTCTCGATCTTTCTTATAATTTTTTCGATAGTTTAATGCCTGAGTGGATTTTTAGTCTTGATAAGCTAGTTTCATTGGATCTTTCTAGATGCCTTTTTCATGGTACTCCGGTTCC...

Protein

Download Protein FASTA

845 aa · TkA02G587840|TK1151|PROTEIN

MSGYDLHIASEWLQVVHTLPALEELHLSSCNLSQIPRHPTVVNFTSLTILDLSYNFFDSLMPEWIFSLDKLVSLDLSRCLFHGTPVPGTVTGFNNLTSLKFLHVTENQYMNSPSVLKGLLTLKSLVSFDLSTCGISTPILGSLENMTSLISIDLSQNHIAETLPNSIGNLCNLTRIDLRSNNFSGSVSGLLANLCECKSPKLDYLAFSSNELSGRIPDKIGNLRHLVTFDLAYNTISGIIPYSFGRLSFLRELMLNVNSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G587840`
TK1151 ID	TkA02G587840
OH-1004 ID	LXL04_012095
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 69.474 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G587840

Location Chr02:151698249-151702413 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13900`	Receptor-like protein 49.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012095 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G11010

ath:AT3G11080

ath:AT4G13920

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.869

Rank 1 · TkA02G587840 · TK1151

Endoplasmic reticulum0.090

Rank 2 · TkA02G587840 · TK1151

Cytoplasm0.056

Rank 3 · TkA02G587840 · TK1151

Nucleus0.046

Rank 4 · TkA02G587840 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA02G587840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25013LRR_Zer-114-37 aa

PF23598LRR_1416-185 aa

PF23952LRR_EndoS16-55 aa

PF24048LRR_NXF1-518-81 aa

PF13855LRR_820-80 aa

PF12799LRR_420-59 aa

PF23286LRR_1320-79 aa

PF00560LRR_122-36 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G587840	`PF25013`	LRR_Zer-1	14	37	0.00055	20.8
TkA02G587840	`PF23598`	LRR_14	16	185	1.6e-45	156.1
TkA02G587840	`PF23952`	LRR_EndoS	16	55	7.4e-05	23.7
TkA02G587840	`PF24048`	LRR_NXF1-5	18	81	0.0001	22.7
TkA02G587840	`PF13855`	LRR_8	20	80	3.5e-48	161.9
TkA02G587840	`PF12799`	LRR_4	20	59	6.3e-33	112.8
TkA02G587840	`PF23286`	LRR_13	20	79	1.6e-06	28.7
TkA02G587840	`PF00560`	LRR_1	22	36	1.6e-58	182.6
TkA02G587840	`PF13516`	LRR_6	22	32	1.2e-06	28.8
TkA02G587840	`PF24758`	LRR_At5g56370	44	105	0.017	15.5
TkA02G587840	`PF12799`	LRR_4	45	79	6.3e-33	112.8
TkA02G587840	`PF13516`	LRR_6	45	55	1.2e-06	28.8
TkA02G587840	`PF00560`	LRR_1	46	68	1.6e-58	182.6
TkA02G587840	`PF00560`	LRR_1	70	87	1.6e-58	182.6
TkA02G587840	`PF13516`	LRR_6	70	79	1.2e-06	28.8
TkA02G587840	`PF12799`	LRR_4	71	107	6.3e-33	112.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVM3`	Arabidopsis thaliana	sp\|Q9SVM3\|RLP49_ARATH Receptor-like protein 49	38.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card