Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1662 bp · TkA02G587500|TK1151|cDNA
ATGAGTGTTGCTTATTTTATTTCGCTTTTCTCTTGCTTACTTGTTGTAATTGTGGCCTTACTTCCTTTATGCACATCAAATAACAACTTATGCAAGGATGATGAGAGACAAGCCCTTCTAGAGTTCAAACATGGCCTCGTAGATGAAGCAAATCGACTTGCTTCATGGGCCGGCCCAAAGACCGATTGCTGCACATGGACCGGAATATTTTGTGATAACTCAACAGGTCATGTACAAAAGATTCACCTTCCGAATAATTG...
1662 bp · TkA02G587500|TK1151|CDS
ATGAGTGTTGCTTATTTTATTTCGCTTTTCTCTTGCTTACTTGTTGTAATTGTGGCCTTACTTCCTTTATGCACATCAAATAACAACTTATGCAAGGATGATGAGAGACAAGCCCTTCTAGAGTTCAAACATGGCCTCGTAGATGAAGCAAATCGACTTGCTTCATGGGCCGGCCCAAAGACCGATTGCTGCACATGGACCGGAATATTTTGTGATAACTCAACAGGTCATGTACAAAAGATTCACCTTCCGAATAATTG...
Protein
Download Protein FASTA553 aa · TkA02G587500|TK1151|PROTEIN
MSVAYFISLFSCLLVVIVALLPLCTSNNNLCKDDERQALLEFKHGLVDEANRLASWAGPKTDCCTWTGIFCDNSTGHVQKIHLPNNCYIDVITTLKHAQECHKQRLSVNISPSLLHLKQLKHIDLSHNDFKGIQIPSFIGSFKSLRYLNLSRSRFGGTLPYDIGQLTYLIDLQLPNNDIVGIIPDSMGLLSSLKSLDLQNIHISGPIPYSVGKLSSLEMLDLSYNQLNGSLPSALGQLSKLVLLDFSNNRLNGPQFPAWL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G587500 |
|---|---|
| TK1151 ID | TkA02G587500 |
| OH-1004 ID | LXL04_012101 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 49.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 77.234Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G587500 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:151607317-151612487 (+) | |||||||||
| Description | Similar to EIX2: Receptor-like protein EIX2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0050832 defense response to fungus Biological Process GO:0005886 plasma membrane Cellular Component | |||||||||
| KEGG gene cross-reference | sly:543900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08263LRRNT_233-72 aaPF23952LRR_EndoS90-151 aaPF23211LRR_LRWD1105-156 aaPF25013LRR_Zer-1112-129 aaPF23598LRR_14113-301 aaPF13855LRR_8114-153 aaPF14580LRR_9117-196 aaPF12799LRR_4118-152 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G587500 | PF08263 | LRRNT_2 | 33 | 72 | 6.1e-14 | 52.7 |
| TkA02G587500 | PF23952 | LRR_EndoS | 90 | 151 | 3.7 | 8.5 |
| TkA02G587500 | PF23211 | LRR_LRWD1 | 105 | 156 | 1.5e-06 | 28.8 |
| TkA02G587500 | PF25013 | LRR_Zer-1 | 112 | 129 | 1.2e-05 | 26.2 |
| TkA02G587500 | PF23598 | LRR_14 | 113 | 301 | 4.6e-21 | 75.7 |
| TkA02G587500 | PF13855 | LRR_8 | 114 | 153 | 1.1e-37 | 128.3 |
| TkA02G587500 | PF14580 | LRR_9 | 117 | 196 | 1.0 | 9.6 |
| TkA02G587500 | PF12799 | LRR_4 | 118 | 152 | 1.6e-26 | 92.4 |
| TkA02G587500 | PF00560 | LRR_1 | 119 | 138 | 2.5e-38 | 122.5 |
| TkA02G587500 | PF24048 | LRR_NXF1-5 | 119 | 162 | 1.6 | 9.1 |
| TkA02G587500 | PF13516 | LRR_6 | 120 | 130 | 8.1e-07 | 29.3 |
| TkA02G587500 | PF07723 | LRR_2 | 120 | 132 | 0.00042 | 21.5 |
| TkA02G587500 | PF24141 | LRR_ComC | 135 | 186 | 0.0034 | 17.8 |
| TkA02G587500 | PF25013 | LRR_Zer-1 | 140 | 199 | 1.2e-05 | 26.2 |
| TkA02G587500 | PF00560 | LRR_1 | 144 | 166 | 2.5e-38 | 122.5 |
| TkA02G587500 | PF13855 | LRR_8 | 144 | 200 | 1.1e-37 | 128.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.