TkA02G587150 | RubberDandelionOmics

Gene overview

TkA02G587150

Reference: TK1151 Chr: Chr02 Coordinates: 151501899-151505287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2792 bp · TkA02G587150|TK1151|cDNA

GAGCGATTGAATTTCTTTGCTTTTTTCTTTTTAATATCTGTTATTTACTTTTAAAGAAAAAAAAAAGGTGTTTCGAAGAAATATCTTCCCCAAATTTGCAGCGATCACACGTTACTCCATTTTTAATGCAAATTCAATCCTTTTCAAATGTACCATTTCGTTTCTTTTCTCATTTTTGAATCGAATTGAAGCTTTCTTATCGATTCCAAGAAAACCCTAGAATTTGATACTCTCATTCTGTTTAGAGCGATTCTGGAAGC...

CDS

Download CDS FASTA

1398 bp · TkA02G587150|TK1151|CDS

ATGCGTCGATTAATGGAAACAACAGGTGTTAACGTTGATCCAACGAGTTCTGATAATCATGCGACTAATAGTCCGAATTCATCAAACCCTACATCTCCGACGATGCGGAGGACAAGCAGTAGCAGTTCGTCGCCGAGAGCGATGTCGTCTTCTCCGTTTCCGATAATTCGTTTCCTACAAGCACCTGTAACTACTCTAATTGAATACTCGGGTGTTCTTCGACCTAGGTCGAATTCCGATTATCACGAATCAGAGAGCTT...

Protein

Download Protein FASTA

465 aa · TkA02G587150|TK1151|PROTEIN

MRRLMETTGVNVDPTSSDNHATNSPNSSNPTSPTMRRTSSSSSSPRAMSSSPFPIIRFLQAPVTTLIEYSGVLRPRSNSDYHESESLISNHNHRDHSSSGSGTASNRSSNGDNSNGEVSIRIMGGADQEEERGSPVAVNRGDGGGEREVSDSGDGSGGNGGSNNNVDSAYQQRYDLQQVSRWIEQILPFSLLLLIVFIRQHLQGLFVTIYITAFMYKSNDILRKQTALKGERKLSVLAGYSLVFMLHTIGVYWWYQDDDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G587150`
TK1151 ID	TkA02G587150
OH-1004 ID	LXL04_019088
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.500
Protein coverage (%)	TK1151 88.817 / OH-1004 95.592 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G587150`
Location	Chr02:151501899-151505287 (+)
Description	Similar to RNFT2: RING finger and transmembrane domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019088` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0051865 protein autoubiquitination Biological Process GO:1904294 positive regulation of ERAD pathway Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0043130 ubiquitin binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	hsa:51136 hsa:84900 mmu:269695 pon:100174460 xla:414607 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.470

Rank 1 · TkA02G587150 · TK1151

Golgi apparatus0.303

Rank 2 · TkA02G587150 · TK1151

Cytoplasm0.146

Rank 3 · TkA02G587150 · TK1151

Nucleus0.143

Rank 4 · TkA02G587150 · TK1151

Lysosome / Vacuole0.084

Rank 5 · TkA02G587150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17120zf-RING_16252-261 aa

PF18912DZR_2397-441 aa

PF12773DZR398-441 aa

PF12678zf-rbx1401-442 aa

PF21272FYVE_CARP1-2401-408 aa

PF13920zf-C3HC4_3402-445 aa

PF13639zf-RING_2403-442 aa

PF24921RING_XB3-XBAT31403-443 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G587150	`PF17120`	zf-RING_16	252	261	0.0028	17.9
TkA02G587150	`PF18912`	DZR_2	397	441	7.4	7.2
TkA02G587150	`PF12773`	DZR	398	441	1.2	10.1
TkA02G587150	`PF12678`	zf-rbx1	401	442	1.2e-07	32.6
TkA02G587150	`PF21272`	FYVE_CARP1-2	401	408	5.1	8.0
TkA02G587150	`PF13920`	zf-C3HC4_3	402	445	3.2e-10	40.4
TkA02G587150	`PF13639`	zf-RING_2	403	442	4.6e-11	43.5
TkA02G587150	`PF24921`	RING_XB3-XBAT31	403	443	0.041	14.6
TkA02G587150	`PF11789`	zf-Nse	403	441	0.19	12.3
TkA02G587150	`PF00097`	zf-C3HC4	404	441	8.5e-10	39.0
TkA02G587150	`PF13923`	zf-C3HC4_2	404	441	1.6e-08	34.9
TkA02G587150	`PF13445`	zf-RING_UBOX	404	439	2.7e-08	34.4
TkA02G587150	`PF14634`	zf-RING_5	404	442	1e-07	32.5
TkA02G587150	`PF14447`	Prok-RING_4	404	446	6e-05	23.6
TkA02G587150	`PF15227`	zf-C3HC4_4	404	441	9.9e-05	23.1
TkA02G587150	`PF14835`	zf-RING_6	404	443	0.00016	22.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card