TkA02G585250 | RubberDandelionOmics

Gene overview

TkA02G585250

Reference: TK1151 Chr: Chr02 Coordinates: 151027011-151028902 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

959 bp · TkA02G585250|TK1151|cDNA

ATAAGGATGAATATATTGATTCTCATTTGATATTATGTAGAGAGAGAACGTTATAAATTACAGAGAGAGAGAGAAAGAATAATATGAATAGGATTTGGGGGGGACTGCATCGAATCGAGAGCAAACAAAAAGAAGATCACGAAATATCTGTGACCCTGCATTTGATTTCCCCCCTCTCTCTCAGTCTTCTATTTCTCTCTCTCTATACGTATATATGCATCTATATATATGTATGTGTATCGATGTCCTCATGCTCATAT...

CDS

Download CDS FASTA

546 bp · TkA02G585250|TK1151|CDS

ATGTATGTGTATCGATGTCCTCATGCTCATATCACGCTGCAATCAGTCATTTCGAATCTGATCTTCTTTGAAAAGTGTTTAGCCGACACAGCTGATTTCATCCTCAATTTCGCATCTATGGAGTGTTATGGAGAAGACGTACCTCATGTTCTAGCTGTTGATGATAATCTCATTGATCGTAAACTCGTTGAAAAATTGCTCAAAAGTTCTTCCTGCAGAGTTACTACGGCAGAAAATGGGATGAGAGCATTGGAGTATTT...

Protein

Download Protein FASTA

181 aa · TkA02G585250|TK1151|PROTEIN

MYVYRCPHAHITLQSVISNLIFFEKCLADTADFILNFASMECYGEDVPHVLAVDDNLIDRKLVEKLLKSSSCRVTTAENGMRALEYLGLRENHQQNNGSKVNMIITDYCMPGMTGYELLQKIKESSWLKEVPVIIMSSENIPTRINECLEMGAEMFMLKPLKLSDVKKLRHQLTNVEVVKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G585250`
TK1151 ID	TkA02G585250
OH-1004 ID	LXL04_012150
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G585250

Location Chr02:151027011-151028902 (+)

Description Similar to ARR17: Two-component response regulator ARR17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56380`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`At2g40670`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`At1g59940`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	Type-A Arabidopsis response regulators are partially redundant negative regulators of cytokinin signaling.2004 · DOI: 10.1105/tpc.018978

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q4GZK7`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release
`Os01g0952500`	Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012150 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010114 response to red light Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000156 phosphorelay response regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G59940

ath:AT2G40670

ath:AT3G56380

ath:AT3G57040

ath:AT5G62920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.600

Rank 1 · TkA02G585250 · TK1151

Cytoplasm0.447

Rank 2 · TkA02G585250 · TK1151

Cell membrane0.079

Rank 3 · TkA02G585250 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA02G585250 · TK1151

Lysosome / Vacuole0.032

Rank 5 · TkA02G585250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072Response_reg50-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G585250	`PF00072`	Response_reg	50	167	7.8e-22	78.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPR6`	Arabidopsis thaliana	sp\|Q9FPR6\|ARR17_ARATH Two-component response regulator ARR17	73.100%	Swiss-Prot	High
`Q9SHC2`	Arabidopsis thaliana	sp\|Q9SHC2\|ARR16_ARATH Two-component response regulator ARR16	71.200%	Swiss-Prot	High
`Q9ZWS9`	Arabidopsis thaliana	sp\|Q9ZWS9\|ARR3_ARATH Two-component response regulator ARR3	62.600%	Swiss-Prot	High
`Q4GZK7`	Oryza sativa subsp. indica	sp\|Q4GZK7\|ORR4_ORYSI Two-component response regulator ORR4	60.300%	Swiss-Prot	Medium
`Q942A1`	Oryza sativa subsp. japonica	sp\|Q942A1\|ORR4_ORYSJ Two-component response regulator ORR4	60.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card