TkA02G584890 | RubberDandelionOmics

Gene overview

TkA02G584890

Reference: TK1151 Chr: Chr02 Coordinates: 150905303-150907231 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1148 bp · TkA02G584890|TK1151|cDNA

GGGAAGTATACAGATTTACACGTTGCACACAGATTCCATTTGGAACCTTGGAATCATTTCGGTGCGATATACTATACATCTCTTCCTCTACTTCCGATTTCTGTCAATTAACTCACCCAACAAATGGCTCTTCGAACCCTCGTCAGTCGCAAAACCCTAGGACCATTGTCCAGGTTTCAACAACAGATTCGTGGACTTCAGACTTTTACGCTTCCGGATCTTGCCTACGATTATGGCGCTCTGGAGCCGGCGATTAGCGC...

CDS

Download CDS FASTA

687 bp · TkA02G584890|TK1151|CDS

ATGGCTCTTCGAACCCTCGTCAGTCGCAAAACCCTAGGACCATTGTCCAGGTTTCAACAACAGATTCGTGGACTTCAGACTTTTACGCTTCCGGATCTTGCCTACGATTATGGCGCTCTGGAGCCGGCGATTAGCGCAGAGATTATGCAGCTCCATCACCAGAAACATCACCAGGCTTACATCACCAACTACAATAAAGCTCTCGAGCAGCTCGATGACGCCATCGCCAAGGGCGATGCCTCCACCGCCGTCAAATTGCA...

Protein

Download Protein FASTA

228 aa · TkA02G584890|TK1151|PROTEIN

MALRTLVSRKTLGPLSRFQQQIRGLQTFTLPDLAYDYGALEPAISAEIMQLHHQKHHQAYITNYNKALEQLDDAIAKGDASTAVKLQSAIKFNGGGHVNHSIFWKNLAPTSEGGGEAPHGSLGWAIDQHFGSFEKLIAKMNTEGAGVQGSGWVWLAVDKELKRLVVETTANQDPLVTKGASLAPLVGIDVWEHAYYLQYKNVRPDYLKNIWKVINWKYASEIYEKECP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G584890`
TK1151 ID	TkA02G584890
OH-1004 ID	LXL04_012159
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G584890

Location Chr02:150905303-150907231 (-)

Description Similar to SODA: Superoxide dismutase [Mn], mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10920`	Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012159 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0019430 removal of superoxide radicals Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004784 superoxide dismutase activity Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0030145 manganese ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G10920

cann:107871142

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.924

Rank 1 · TkA02G584890 · TK1151

Cytoplasm0.098

Rank 2 · TkA02G584890 · TK1151

Nucleus0.049

Rank 3 · TkA02G584890 · TK1151

Plastid0.023

Rank 4 · TkA02G584890 · TK1151

Cell membrane0.021

Rank 5 · TkA02G584890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00081Sod_Fe_N27-108 aa

PF02777Sod_Fe_C52-65 aa

PF02777Sod_Fe_C119-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G584890	`PF00081`	Sod_Fe_N	27	108	2.2e-33	115.3
TkA02G584890	`PF02777`	Sod_Fe_C	52	65	8.9e-37	126.0
TkA02G584890	`PF02777`	Sod_Fe_C	119	221	8.9e-37	126.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81235`	Arabidopsis thaliana	sp\|O81235\|SODM1_ARATH Superoxide dismutase [Mn] 1, mitochondrial	79.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card