TkA02G584700 | RubberDandelionOmics

Gene overview

TkA02G584700

Reference: TK1151 Chr: Chr02 Coordinates: 150864210-150870806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1288 bp · TkA02G584700|TK1151|cDNA

GGCCACCCGACTGAGATTAAGGCATAATTTTGTACAGTTCAAGTGGGTGTTCAACAGGAAATTAGGTTTCGAGGCATTTACCACTTTGATTTCTTATTTTAAGAAATCTAAGCTCCATTTTAACTCTAGAGCTTCCATAACACATTCTAGATACGTGTTTATTGTTCTTACCGAGACTAGAGCTACCAAAACACCTCCTAAATATGTATGTATGTGTGTTCTTCTTGTGATTTTTTAGCAAATAGCAACTAGAAGATCGA...

CDS

Download CDS FASTA

624 bp · TkA02G584700|TK1151|CDS

ATGGTGAGGGCACCTTGCATCGACAAAAATGGCATGAAAAAGGGAGCTTGGAGCGAAGAAGAAGATAATAAGCTACGAGATTACATTGAACGGTATGGCCACTGGAATTGGCGTGAACTTCCGAAGTATGCCGGTTTATCAAGGTGCGGCAAGAGTTGCAGATTGAGATGGATGAATTATCTTAGACCAAGCGTGAAACGCGGAAATTTTAGCAAGGAAGAAGAAGATATCATCATCAAATTTCATCAAGACATGGGAAA...

Protein

Download Protein FASTA

207 aa · TkA02G584700|TK1151|PROTEIN

MVRAPCIDKNGMKKGAWSEEEDNKLRDYIERYGHWNWRELPKYAGLSRCGKSCRLRWMNYLRPSVKRGNFSKEEEDIIIKFHQDMGNKWSAIAAQLPGRSDNEIKNHWHTHLKKRSTKHNHQVPHDLKEEQNLNMERIINFAGLPPSVVSTSSDNRISNESTSSHRLSDDSNSMSRPCLQQRLLIDLNQEYVESWEEDSKSEKEFEC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G584700`
TK1151 ID	TkA02G584700
OH-1004 ID	LXL04_012163
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G584700

Location Chr02:150864210-150870806 (-)

Description Similar to MYB4: Transcription factor MYB4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16490`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321
`At4g28110`	Transcription factor involved in salt stress response.	AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.2009 · DOI: 10.1104/pp.108.134874 Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.2012 · DOI: 10.1016/j.bbrc.2012.04.137 AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.2014 · DOI: 10.1111/tpj.12624
`At2g31180`	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes.	AtMYB14 Regulates Cold Tolerance in Arabidopsis. 2013 · DOI: 10.1007/s11105-012-0481-z
`At1g56160`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	Expression differences for genes involved in lignin, glutathione and sulphate metabolism in response to cadmium in Arabidopsis thaliana and the related Zn/Cd-hyperaccumulator Thlaspi caerulescens.2008 · DOI: 10.1111/j.1365-3040.2007.01764.x MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.2008 · DOI: 10.1104/pp.107.113829 MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe.2009 · DOI: 10.1111/j.1438-8677.2008.00162.x β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots.2014 · DOI: 10.1111/nph.12980
`At3g23250`	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance.	A R2R3 type MYB transcription factor is involved in the cold regulation of CBF genes and in acquired freezing tolerance.2006 · DOI: 10.1074/jbc.m605895200 Transgenic expression of MYB15 confers enhanced sensitivity to abscisic acid and improved drought tolerance in Arabidopsis thaliana.2009 · DOI: 10.1016/s1673-8527(09)60003-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0517100`	Transcriptional activator involved in cold stress response.	Overexpression of the rice Osmyb4 gene increases chilling and freezing tolerance of Arabidopsis thaliana plants.2004 · DOI: 10.1046/j.1365-313x.2003.01938.x Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.2010 · DOI: 10.1111/j.1365-3040.2010.02221.x The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.2012 · DOI: 10.1007/s13353-011-0081-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012163 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT2G31180

ath:AT3G23250

ath:AT4G21440

ath:AT4G28110

dosa:Os04g0517100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA02G584700 · TK1151

Cytoplasm0.172

Rank 2 · TkA02G584700 · TK1151

Mitochondrion0.023

Rank 3 · TkA02G584700 · TK1151

Cell membrane0.016

Rank 4 · TkA02G584700 · TK1151

Endoplasmic reticulum0.006

Rank 5 · TkA02G584700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_713-33 aa

PF00249Myb_DNA-binding14-61 aa

PF13274SocA_Panacea15-43 aa

PF13921Myb_DNA-bind_617-75 aa

PF13274SocA_Panacea65-87 aa

PF00249Myb_DNA-binding67-112 aa

PF15963Myb_DNA-bind_767-136 aa

PF13921Myb_DNA-bind_670-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G584700	`PF15963`	Myb_DNA-bind_7	13	33	0.0048	17.4
TkA02G584700	`PF00249`	Myb_DNA-binding	14	61	7.2e-35	119.6
TkA02G584700	`PF13274`	SocA_Panacea	15	43	0.069	14.9
TkA02G584700	`PF13921`	Myb_DNA-bind_6	17	75	1e-23	84.0
TkA02G584700	`PF13274`	SocA_Panacea	65	87	0.069	14.9
TkA02G584700	`PF00249`	Myb_DNA-binding	67	112	7.2e-35	119.6
TkA02G584700	`PF15963`	Myb_DNA-bind_7	67	136	0.0048	17.4
TkA02G584700	`PF13921`	Myb_DNA-bind_6	70	115	1e-23	84.0
TkA02G584700	`PF13274`	SocA_Panacea	101	140	0.069	14.9
TkA02G584700	`PF13921`	Myb_DNA-bind_6	181	196	1e-23	84.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA47`	Arabidopsis thaliana	sp\|Q9SA47\|MYB58_ARATH Transcription factor MYB58	64.900%	Swiss-Prot	Medium
`Q9M0J5`	Arabidopsis thaliana	sp\|Q9M0J5\|MYB41_ARATH Transcription factor MYB41	71.300%	Swiss-Prot	Medium
`Q9SJX8`	Arabidopsis thaliana	sp\|Q9SJX8\|MYB14_ARATH Transcription factor MYB14	67.800%	Swiss-Prot	Medium
`Q9SGU3`	Arabidopsis thaliana	sp\|Q9SGU3\|MYB72_ARATH Transcription factor MYB72	55.200%	Swiss-Prot	High
`Q9LTC4`	Arabidopsis thaliana	sp\|Q9LTC4\|MYB15_ARATH Transcription factor MYB15	80.300%	Swiss-Prot	Low
`Q7XBH4`	Oryza sativa subsp. japonica	sp\|Q7XBH4\|MYB4_ORYSJ Transcription factor MYB4	72.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card