TkA02G583280 | RubberDandelionOmics

Gene overview

TkA02G583280

Reference: TK1151 Chr: Chr02 Coordinates: 150494737-150497591 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2362 bp · TkA02G583280|TK1151|cDNA

ATTTTTCATAAACGAAGGAATAGAGTTGCCGTATTATAAAGCAATGCCGCTCGATAACTCCGGTCCATTTCATCTTTCATGCCACTGGACGTTTTCTTGTAGACGGCCGTTAATCGGTCAAGCTAAGTGGCTTCGCTTTGACCGAATAATTCAATCCACCAGCTGCCAAATCGCAGATTTTTCAAGTGGAATACAAAAGAACCTTCTTCCTATCATTCATCTGTTTCTGAACCTCTTTTCCCCCGTTTATTGATCCTCAA...

CDS

Download CDS FASTA

1500 bp · TkA02G583280|TK1151|CDS

ATGACTTCAAATGATAATGGTGTAGTTGAAGAAGAGAAATCAAACGGATGTAGAATCAAACCTGTAGTCAATCTAGAGATCGAAACCTCTAGAAGAGGTCTTCTTAAGGATGAAGTTTCCCAAATTCAGATCGATAGTACTACTACTACCCCTACTCCTCTATCCAACAGAACCCCAAGTTTCCTTGTATTCGGTAATCTAGCTACACCAACTGCAAAATTCCAAAGAATCGCCCAAGACAGAGACAATTTCTCACGCAC...

Protein

Download Protein FASTA

499 aa · TkA02G583280|TK1151|PROTEIN

MTSNDNGVVEEEKSNGCRIKPVVNLEIETSRRGLLKDEVSQIQIDSTTTTPTPLSNRTPSFLVFGNLATPTAKFQRIAQDRDNFSRTVPSSASQAIRDRFTSVFSKKIDWISLQKLAKEWIRDPMNMVLLIWIIVVAVSGAILFLVMTGMLNHVLPKKSQRDAWFEVNNQILNALFTLMCLYQHPHRLYHLVLLIRWKPEDIAKLRKIYCKNATYKPHEWAHMLVVVLLLNLNCFAQYALCGLNVGYKRSERPAIGVGIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G583280`
TK1151 ID	TkA02G583280
OH-1004 ID	LXL04_012180
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 83.968 / OH-1004 78.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G583280`
Location	Chr02:150494737-150497591 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012180` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.309

Rank 1 · TkA02G583280 · TK1151

Endoplasmic reticulum0.246

Rank 2 · TkA02G583280 · TK1151

Lysosome / Vacuole0.226

Rank 3 · TkA02G583280 · TK1151

Golgi apparatus0.168

Rank 4 · TkA02G583280 · TK1151

Cytoplasm0.163

Rank 5 · TkA02G583280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20237DUF659491-150 aa

PF11204DUF2985119-197 aa

PF06305LapA_dom127-150 aa

PF13301DUF4079130-230 aa

PF06570DUF1129130-182 aa

PF04749PLAC8158-158 aa

PF04749PLAC8233-233 aa

PF06305LapA_dom258-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G583280	`PF20237`	DUF6594	91	150	0.32	11.6
TkA02G583280	`PF11204`	DUF2985	119	197	2.2e-30	105.2
TkA02G583280	`PF06305`	LapA_dom	127	150	0.34	11.6
TkA02G583280	`PF13301`	DUF4079	130	230	0.75	10.7
TkA02G583280	`PF06570`	DUF1129	130	182	1.4	9.2
TkA02G583280	`PF04749`	PLAC8	158	158	1.9e-09	39.0
TkA02G583280	`PF04749`	PLAC8	233	233	1.9e-09	39.0
TkA02G583280	`PF06305`	LapA_dom	258	278	0.34	11.6
TkA02G583280	`PF04749`	PLAC8	324	419	1.9e-09	39.0
TkA02G583280	`PF20237`	DUF6594	366	409	0.32	11.6
TkA02G583280	`PF06570`	DUF1129	370	409	1.4	9.2
TkA02G583280	`PF13301`	DUF4079	415	452	0.75	10.7
TkA02G583280	`PF04749`	PLAC8	469	469	1.9e-09	39.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card