TkA02G572500 | RubberDandelionOmics

Gene overview

TkA02G572500

Reference: TK1151 Chr: Chr02 Coordinates: 147826235-147830230 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1068 bp · TkA02G572500|TK1151|cDNA

ATGAAAAAAGAGGTTGACCCGTTTATCTCTCTCCCAAATGACATCCTTTTAGATATCCTTAAAAAGCTTCCGGATCCTGTCCTTCGTTATAAGGCTAAGTATGTCTGTAAAAGATGGTTCGATATAATCACAAACACCATCTTATTAGACGACGCTTCTTTTATCATCCAGAAGTCAAGTGGAATTTACACATCGCGAGTTGTGGGTATAAGGAAAGAACAACAAGGGGTACTAGTGAAAGTGCACAATCTCGACATACC...

CDS

Download CDS FASTA

1068 bp · TkA02G572500|TK1151|CDS

ATGAAAAAAGAGGTTGACCCGTTTATCTCTCTCCCAAATGACATCCTTTTAGATATCCTTAAAAAGCTTCCGGATCCTGTCCTTCGTTATAAGGCTAAGTATGTCTGTAAAAGATGGTTCGATATAATCACAAACACCATCTTATTAGACGACGCTTCTTTTATCATCCAGAAGTCAAGTGGAATTTACACATCGCGAGTTGTGGGTATAAGGAAAGAACAACAAGGGGTACTAGTGAAAGTGCACAATCTCGACATACC...

Protein

Download Protein FASTA

355 aa · TkA02G572500|TK1151|PROTEIN

MKKEVDPFISLPNDILLDILKKLPDPVLRYKAKYVCKRWFDIITNTILLDDASFIIQKSSGIYTSRVVGIRKEQQGVLVKVHNLDIPFERIKSWYNEFLLIMDCSRDKSLYLFNLITNERSYLPECHTDCRPHFSDRCGVALCFDGFDGVYKVVHFFMGPPFECHVLKLGSEIVSSVTSSWKKMEIGSDMEDPDWQYDPNDLVSVQVQGRYFHWDVHSSNYLVSMDITKEEIFQLTLPGSNDDDSMCSYYSIFEMGGFLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G572500`
TK1151 ID	TkA02G572500
OH-1004 ID	LXL04_012301
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.600
Protein coverage (%)	TK1151 97.746 / OH-1004 31.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G572500`
Location	Chr02:147826235-147830230 (+)
Description	Similar to TOC34: Translocase of chloroplast 34
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012301` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000338 protein deneddylation Biological Process GO:0006886 intracellular protein transport Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009640 photomorphogenesis Biological Process GO:0010100 negative regulation of photomorphogenesis Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0019750 chloroplast localization Biological Process GO:0045036 protein targeting to chloroplast Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G02280 ath:AT3G07870 ath:AT5G05000 ath:AT5G42970 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA02G572500 · TK1151

Nucleus0.407

Rank 2 · TkA02G572500 · TK1151

Cell membrane0.118

Rank 3 · TkA02G572500 · TK1151

Endoplasmic reticulum0.093

Rank 4 · TkA02G572500 · TK1151

Lysosome / Vacuole0.058

Rank 5 · TkA02G572500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like10-47 aa

PF00646F-box10-47 aa

PF08268FBA_378-298 aa

PF03478Beta-prop_KIB1-482-262 aa

PF00646F-box327-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G572500	`PF12937`	F-box-like	10	47	2.8e-07	30.9
TkA02G572500	`PF00646`	F-box	10	47	0.00037	21.0
TkA02G572500	`PF08268`	FBA_3	78	298	2.1e-11	44.1
TkA02G572500	`PF03478`	Beta-prop_KIB1-4	82	262	0.0012	19.2
TkA02G572500	`PF00646`	F-box	327	336	0.00037	21.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card