TkA02G569330 | RubberDandelionOmics

Gene overview

TkA02G569330

Reference: TK1151 Chr: Chr02 Coordinates: 147071683-147074932 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2592 bp · TkA02G569330|TK1151|cDNA

TTTTGGTTGTGTATAGATAGATGATCATGGATGGGCTATGGGAGGCGGATTATGGGCTATCTAACCTGAACGCCGCAAAATTCAATGGATCTGCGACAGTTCTATCAGATCAGAAGTTTCTTAATGCGATGAGTCTCAACGAAACATTTCTAGATCGAAATTCTACTACTCATACTCCGGAGTTACCTGATCTCGGCCTTAGAAGATTCAGTCCTCCTTCTAGCTCAAACAATGAAGCGGACCTTCATGAAGATTTTGAC...

CDS

Download CDS FASTA

1218 bp · TkA02G569330|TK1151|CDS

ATGATCATGGATGGGCTATGGGAGGCGGATTATGGGCTATCTAACCTGAACGCCGCAAAATTCAATGGATCTGCGACAGTTCTATCAGATCAGAAGTTTCTTAATGCGATGAGTCTCAACGAAACATTTCTAGATCGAAATTCTACTACTCATACTCCGGAGTTACCTGATCTCGGCCTTAGAAGATTCAGTCCTCCTTCTAGCTCAAACAATGAAGCGGACCTTCATGAAGATTTTGACCTTAGCGATGTAGTTTTCAA...

Protein

Download Protein FASTA

405 aa · TkA02G569330|TK1151|PROTEIN

MIMDGLWEADYGLSNLNAAKFNGSATVLSDQKFLNAMSLNETFLDRNSTTHTPELPDLGLRRFSPPSSSNNEADLHEDFDLSDVVFKYINQMLMEEDIEEKTCMLHESAALQAAEKSFYDALMVNEPRFSTPHPTVPLYNNDGREEITLTDYNGFGGNSSISGTSLSCDVTDYDSPLVPSSSVNLDSESRSQSSYCSSTSNSYSMDSLTDSPLSIQSNRSAMQFQKGISRSLLSNENKKSTNPVVIKSENNKQQRSSIPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G569330`
TK1151 ID	TkA02G569330
OH-1004 ID	LXL04_012371
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 90.864 / OH-1004 54.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G569330

Location Chr02:147071683-147074932 (-)

Description Similar to SCL14: Scarecrow-like protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07530`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g29060`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g37650`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At2g29065`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At5g59450`	Probable transcription factor involved in plant development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012371 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080183 response to photooxidative stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07530

ath:AT2G29060

ath:AT2G29065

ath:AT2G37650

ath:AT5G59450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkA02G569330 · TK1151

Cytoplasm0.162

Rank 2 · TkA02G569330 · TK1151

Cell membrane0.055

Rank 3 · TkA02G569330 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA02G569330 · TK1151

Plastid0.020

Rank 5 · TkA02G569330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24770Ig-CFAP74_2146-269 aa

PF03514GRAS343-402 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G569330	`PF24770`	Ig-CFAP74_2	146	269	0.047	14.9
TkA02G569330	`PF03514`	GRAS	343	402	2.3e-12	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XE58`	Arabidopsis thaliana	sp\|Q9XE58\|SCL14_ARATH Scarecrow-like protein 14	35.000%	Swiss-Prot	Medium
`P0C883`	Arabidopsis thaliana	sp\|P0C883\|SCL33_ARATH Scarecrow-like protein 33	33.000%	Swiss-Prot	Medium
`O80933`	Arabidopsis thaliana	sp\|O80933\|SCL9_ARATH Scarecrow-like protein 9	33.000%	Swiss-Prot	Medium
`P0C884`	Arabidopsis thaliana	sp\|P0C884\|SCL34_ARATH Scarecrow-like protein 34	38.900%	Swiss-Prot	Low
`Q9LTI5`	Arabidopsis thaliana	sp\|Q9LTI5\|SCL11_ARATH Scarecrow-like protein 11	39.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card