TkA02G568610 | RubberDandelionOmics

Gene overview

TkA02G568610

Reference: TK1151 Chr: Chr02 Coordinates: 146875959-146876549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA02G568610|TK1151|cDNA

ATGGAGTCTGTGGTATCAGGTCTAGAAGGAACGCTCTTGAAGAACAATGACCCCTTATCGTATTTTATGCTGGTAGCTTTCGAAGCCTCCGGTAATCCGACCGCCACCTTCCCGTGGGTCCAGCACCGGCGTGCTGTTCGTCTGCACACACCGAACCCTAATGGACCCCGTAGTGTTATGGTCAGTTCTCCAACGCAAGATCCCGGCGGTGACCTACTCGTTATCAAGATTCTCGGAGATCATGTCTCCGATCCCAACTT...

CDS

Download CDS FASTA

480 bp · TkA02G568610|TK1151|CDS

ATGGAGTCTGTGGTATCAGGTCTAGAAGGAACGCTCTTGAAGAACAATGACCCCTTATCGTATTTTATGCTGGTAGCTTTCGAAGCCTCCGGTAATCCGACCGCCACCTTCCCGTGGGTCCAGCACCGGCGTGCTGTTCGTCTGCACACACCGAACCCTAATGGACCCCGTAGTGTTATGGTCAGTTCTCCAACGCAAGATCCCGGCGGTGACCTACTCGTTATCAAGATTCTCGGAGATCATGTCTCCGATCCCAACTT...

Protein

Download Protein FASTA

159 aa · TkA02G568610|TK1151|PROTEIN

MESVVSGLEGTLLKNNDPLSYFMLVAFEASGNPTATFPWVQHRRAVRLHTPNPNGPRSVMVSSPTQDPGGDLLVIKILGDHVSDPNFPFDQKQTQLTDLIVPVAMNHRVGPGFFLHEPETDIRGDVLEPVAGGGYMFVGIKPSRSRELCSENLGGDFRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G568610`
TK1151 ID	TkA02G568610
OH-1004 ID	LXL04_021919
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.100
Protein coverage (%)	TK1151 19.497 / OH-1004 5.699 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G568610

Location Chr02:146875959-146876549 (+)

Description Similar to GPAT5: Glycerol-3-phosphate acyltransferase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06090`	Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021919 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009908 flower development Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0016024 CDP-diacylglycerol biosynthetic process Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0046486 glycerolipid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0004366 glycerol-3-phosphate O-acyltransferase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38110

ath:AT3G11430

ath:AT5G06090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.398

Rank 1 · TkA02G568610 · TK1151

Nucleus0.380

Rank 2 · TkA02G568610 · TK1151

Mitochondrion0.144

Rank 3 · TkA02G568610 · TK1151

Plastid0.093

Rank 4 · TkA02G568610 · TK1151

Cell membrane0.071

Rank 5 · TkA02G568610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23270HAD_RAM2_N3-32 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G568610	`PF23270`	HAD_RAM2_N	3	32	2.3e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHS7`	Arabidopsis thaliana	sp\|Q9LHS7\|GPAT7_ARATH Glycerol-3-phosphate acyltransferase 7	82.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card