TkA02G561450 | RubberDandelionOmics

Gene overview

TkA02G561450

Reference: TK1151 Chr: Chr02 Coordinates: 145027247-145030244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1378 bp · TkA02G561450|TK1151|cDNA

TATATCATGTATATGTTGAATGTCCATTATCGAAAAATAAAATTATGTAATTTATTTCTTACAGTTTAGATACTGTAAACAAAAAGGAAAAAAAAAAAATTCCTGAAATCAGACTCACACTATGTCGGACACCATTTTTACCAAGTTACAGGCGGAAAGCGTCCTTATACGTCAAAAGTTGAGTCAATCATATACCTACACGTGCTCTCTCCTGGCTTAAGGCCCTCCCTCCAAATTCCCCCCCAAACTCATCATTTTGT...

CDS

Download CDS FASTA

771 bp · TkA02G561450|TK1151|CDS

ATGGCGGAAGGTATCGACATGTCACTCGATGATATCATCAAGAACAACAAGAAATCCGGAAAAACTGACATCAATACTAGGTCCAGAGGCGGAGCCCGCAGCGGTGGCCGTGGTCGTGGTTTTGAATCCGGTCGCGGTTTTGAATCCGGTCCCGGCCCCACCAGACGTGTTGACAATCGGGTTACGGCCCGTATGAACCCGTACTTCGTTCCGCAGGCTTTTCATATGCAAAAAATGCTTGTGGGAGGGGAGTCGAATTC...

Protein

Download Protein FASTA

256 aa · TkA02G561450|TK1151|PROTEIN

MAEGIDMSLDDIIKNNKKSGKTDINTRSRGGARSGGRGRGFESGRGFESGPGPTRRVDNRVTARMNPYFVPQAFHMQKMLVGGESNSESGTKLYISNLDEGVTNEDIKVLFSDVGELKRYSIHYDRSGISKGTAEVVYTRQPDAVAAMKRYNNLQLDGKPMRLEMVGLNIVTHVPIPSMQKGILGNPIKPYSSIGGRIVGRGQRRGGGGDFGSGGGGGGGWSRGSGRNGGGPPKKVMSADELDADLEKYRLEAMRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G561450`
TK1151 ID	TkA02G561450
OH-1004 ID	LXL04_012435
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G561450

Location Chr02:145027247-145030244 (+)

Description Similar to ALY2: THO complex subunit 4B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02530`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	No verified direct reference in this release
`At5g59950`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	No verified direct reference in this release
`At5g37720`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	Arabidopsis coactivator ALY-like proteins, DIP1 and DIP2, interact physically with the DNA-binding domain of the Zn-finger poly(ADP-ribose) polymerase.2001 · DOI: 10.1093/jxb/52.359.1375 ALY proteins participate in multifaceted Nep1Mo-triggered responses in Nicotiana benthamiana and Arabidopsis thaliana.2014 · DOI: 10.1093/jxb/eru136
`At1g66260`	Export adapter involved in nuclear export of spliced and unspliced mRNA.	Arabidopsis coactivator ALY-like proteins, DIP1 and DIP2, interact physically with the DNA-binding domain of the Zn-finger poly(ADP-ribose) polymerase.2001 · DOI: 10.1093/jxb/52.359.1375

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006405 RNA export from nucleus Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006952 defense response Biological Process

GO:0008380 RNA splicing Biological Process

GO:0016071 mRNA metabolic process Biological Process

GO:0051028 mRNA transport Biological Process

GO:0000346 transcription export complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT1G66260

ath:AT5G02530

ath:AT5G37720

ath:AT5G59950

mmu:56009

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.850

Rank 1 · TkA02G561450 · TK1151

Cytoplasm0.260

Rank 2 · TkA02G561450 · TK1151

Cell membrane0.018

Rank 3 · TkA02G561450 · TK1151

Mitochondrion0.015

Rank 4 · TkA02G561450 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA02G561450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07078FYTT4-23 aa

PF13865FoP_duplication24-51 aa

PF00076RRM_193-161 aa

PF13865FoP_duplication196-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G561450	`PF07078`	FYTT	4	23	0.035	14.2
TkA02G561450	`PF13865`	FoP_duplication	24	51	1.5e-07	32.6
TkA02G561450	`PF00076`	RRM_1	93	161	1.4e-13	51.2
TkA02G561450	`PF13865`	FoP_duplication	196	251	1.5e-07	32.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L719`	Arabidopsis thaliana	sp\|Q8L719\|THO4B_ARATH THO complex subunit 4B	50.000%	Swiss-Prot	High
`Q8L773`	Arabidopsis thaliana	sp\|Q8L773\|THO4A_ARATH THO complex subunit 4A	52.400%	Swiss-Prot	Medium
`Q6NQ72`	Arabidopsis thaliana	sp\|Q6NQ72\|THO4D_ARATH THO complex subunit 4D	45.700%	Swiss-Prot	Medium
`Q94EH8`	Arabidopsis thaliana	sp\|Q94EH8\|THO4C_ARATH THO complex subunit 4C	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card