TkA02G560210 | RubberDandelionOmics

Gene overview

TkA02G560210

Reference: TK1151 Chr: Chr02 Coordinates: 144715475-144716645 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1013 bp · TkA02G560210|TK1151|cDNA

TCGATTTCATATCAAAGAAGAACTTTTATGTTACTAGAATTCCAAAGGATCCCATAAATTTGGACATCAAACGATTGCTTTTCATATTCCTAACCCAACTCATCATCCAAGTTTAAAAGCAAAGACTCAACCTCTACAGGTTCAAATCAGGAAGCAAATTCCCCTTTTAAGAAACGAAAATGGCAGCCTCATCTTCCGCTTCATCACAAGTAAGCTTGAAGCTTCTGATCGATACCAATGCCAAGAAAGTTTTATTTGCA...

CDS

Download CDS FASTA

690 bp · TkA02G560210|TK1151|CDS

ATGGCAGCCTCATCTTCCGCTTCATCACAAGTAAGCTTGAAGCTTCTGATCGATACCAATGCCAAGAAAGTTTTATTTGCAGAAGCCAACAAAGAATTCGTGGATTTCCTCTTCCACATCCTTTCTCTCCCAATGGGTACTGTGATAAAGCTCCTTACCAAGAACTCGATGGTGGGTTCACTCGGAAAGCTCTACGACAGCATTGAGAACTTGAGCGATACGTATATGCAACCAAATCAAAGCAAAAGTTCAGTTTTGAA...

Protein

Download Protein FASTA

229 aa · TkA02G560210|TK1151|PROTEIN

MAASSSASSQVSLKLLIDTNAKKVLFAEANKEFVDFLFHILSLPMGTVIKLLTKNSMVGSLGKLYDSIENLSDTYMQPNQSKSSVLNPKTVNYGANVPLLLTNDVVPMGRKFYRCSRCYRTVTDDPTVMCPDCSYRMNNETTYVKGNGGVKETGEGGGFVKGVVTYMVMDDLEVKPMSTISSITMLNKFNVKEVGGLQEKLVSLDMTEGLKLLKASLQCKNVLTSVFLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G560210`
TK1151 ID	TkA02G560210
OH-1004 ID	LXL04_012456
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G560210`
Location	Chr02:144715475-144716645 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012456` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.954

Rank 1 · TkA02G560210 · TK1151

Cytoplasm0.099

Rank 2 · TkA02G560210 · TK1151

Cell membrane0.026

Rank 3 · TkA02G560210 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA02G560210 · TK1151

Plastid0.015

Rank 5 · TkA02G560210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05056DUF6749-228 aa

PF04750Far-17a_AIG112-51 aa

PF10235Cript95-138 aa

PF02207zf-UBR105-137 aa

PF17032Zn_ribbon_15109-143 aa

PF23455DUF7129111-139 aa

PF08772Zn_ribbon_NOB1112-136 aa

PF14369Zn_ribbon_19113-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G560210	`PF05056`	DUF674	9	228	5.8e-45	154.7
TkA02G560210	`PF04750`	Far-17a_AIG1	12	51	0.22	11.7
TkA02G560210	`PF10235`	Cript	95	138	0.12	13.7
TkA02G560210	`PF02207`	zf-UBR	105	137	0.17	12.7
TkA02G560210	`PF17032`	Zn_ribbon_15	109	143	0.068	14.7
TkA02G560210	`PF23455`	DUF7129	111	139	0.13	12.7
TkA02G560210	`PF08772`	Zn_ribbon_NOB1	112	136	0.085	13.7
TkA02G560210	`PF14369`	Zn_ribbon_19	113	134	6.0	7.8
TkA02G560210	`PF26388`	DUF6079_6th	126	143	0.065	13.7
TkA02G560210	`PF26388`	DUF6079_6th	169	210	0.065	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card