RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G558570
Reference: TK1151 Chr: Chr02 Coordinates: 144319297-144320502 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1206 bp · TkA02G558570|TK1151|cDNA

ATGGGTGGCAAAACATGCTATATACTCGACTACGAATGCTTCAAGGGAAAGAAGGAGATGATGCTGGACACCCAACAGTGTGCGAAGGTTGTCGCGCGTAACAAGAATCTGCGTATCCAGGATTACAGGTTTCTTATTAAAACCATGGTTAATTCAGGCCTTGGTGAAGATACTTATGGTCCAAAAAGCATCGTATTGGGTGAAGAAGAACACCCTAAACTTGCTGATTCTATATCAGAATTAGACGCCGTGTTCTTCGA...

CDS

Download CDS FASTA

1206 bp · TkA02G558570|TK1151|CDS

ATGGGTGGCAAAACATGCTATATACTCGACTACGAATGCTTCAAGGGAAAGAAGGAGATGATGCTGGACACCCAACAGTGTGCGAAGGTTGTCGCGCGTAACAAGAATCTGCGTATCCAGGATTACAGGTTTCTTATTAAAACCATGGTTAATTCAGGCCTTGGTGAAGATACTTATGGTCCAAAAAGCATCGTATTGGGTGAAGAAGAACACCCTAAACTTGCTGATTCTATATCAGAATTAGACGCCGTGTTCTTCGA...

Protein

Download Protein FASTA

401 aa · TkA02G558570|TK1151|PROTEIN

MGGKTCYILDYECFKGKKEMMLDTQQCAKVVARNKNLRIQDYRFLIKTMVNSGLGEDTYGPKSIVLGEEEHPKLADSISELDAVFFETLDALFARSKITPSQIDILVVTVSLLSTVPSLASRIINRYNMRSDIKAFNIAGMGCSASLVGIDMVQHMFNTQKNKIAIVVSTESMSSHWYCGTEKSMMLSNCIFREGGGSILLTNDNARKNQAILKLKSMVRTHLGSEDDAYKSCFQLEDAKGYGGFHLDRTLTMVAGRALT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G558570
TK1151 IDTkA02G558570
OH-1004 IDLXL04_012481
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)99.500
Protein coverage (%)TK1151 100.000 / OH-1004 75.660
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G558570
LocationChr02:144319297-144320502 (-)
DescriptionSimilar to KCS19: 3-ketoacyl-CoA synthase 19
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g04530 3-ketoacyl-CoA synthase 19. No verified direct reference in this release
At1g07720 3-ketoacyl-CoA synthase 3. No verified direct reference in this release
At2g28630 3-ketoacyl-CoA synthase 12. No verified direct reference in this release
At1g01120 Contributes to cuticular wax and suberin biosynthesis.
KCS1 encodes a fatty acid elongase 3-ketoacyl-CoA synthase affecting wax biosynthesis in Arabidopsis thaliana.1999 · DOI: 10.1046/j.1365-313x.1999.00352.x
Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101
Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
At4g34510 Active on saturated acyl-CoAs up to C22.
Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000038 very long-chain fatty acid metabolic process Biological Process
GO:0006633 fatty acid biosynthetic process Biological Process
GO:0009409 response to cold Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0010025 wax biosynthetic process Biological Process
GO:0030497 fatty acid elongation Biological Process
GO:0042761 very long-chain fatty acid biosynthetic process Biological Process
GO:0070417 cellular response to cold Biological Process
GO:0160062 cutin-based cuticle development Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference
ath:AT1G01120
ath:AT1G07720
ath:AT2G28630
ath:AT4G34510
ath:AT5G04530
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.661
Rank 1 · TkA02G558570 · TK1151
Mitochondrion0.117
Rank 2 · TkA02G558570 · TK1151
Cytoplasm0.101
Rank 3 · TkA02G558570 · TK1151
Cell membrane0.080
Rank 4 · TkA02G558570 · TK1151
Peroxisome0.068
Rank 5 · TkA02G558570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA4-284 aa
PF00108Thiolase_N87-184 aa
PF08541ACP_syn_III_C94-120 aa
PF26808Phage_P22_gp16137-203 aa
PF08545ACP_syn_III141-214 aa
PF08541ACP_syn_III_C294-377 aa
PF02797Chal_sti_synt_C299-370 aa
PF26808Phage_P22_gp16303-371 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G558570PF08392FAE1_CUT1_RppA42845e-105351.7
TkA02G558570PF00108Thiolase_N871840.05213.6
TkA02G558570PF08541ACP_syn_III_C941205e-1143.3
TkA02G558570PF26808Phage_P22_gp161372030.1211.6
TkA02G558570PF08545ACP_syn_III1412140.0002721.5
TkA02G558570PF08541ACP_syn_III_C2943775e-1143.3
TkA02G558570PF02797Chal_sti_synt_C2993702.3e-1041.4
TkA02G558570PF26808Phage_P22_gp163033710.1211.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LZ72Arabidopsis thalianasp|Q9LZ72|KCS19_ARATH 3-ketoacyl-CoA synthase 1959.200%Swiss-ProtHigh
Q9LQP8Arabidopsis thalianasp|Q9LQP8|KCS3_ARATH 3-ketoacyl-CoA synthase 351.100%Swiss-ProtHigh
Q9SIB2Arabidopsis thalianasp|Q9SIB2|KCS12_ARATH 3-ketoacyl-CoA synthase 1250.500%Swiss-ProtHigh
Q9MAM3Arabidopsis thalianasp|Q9MAM3|KCS1_ARATH 3-ketoacyl-CoA synthase 140.800%Swiss-ProtMedium
O65677Arabidopsis thalianasp|O65677|KCS17_ARATH 3-ketoacyl-CoA synthase 1739.900%Swiss-ProtMedium

JBrowse

View in Genome Browser