TkA02G557920 | RubberDandelionOmics

Gene overview

TkA02G557920

Reference: TK1151 Chr: Chr02 Coordinates: 144120472-144122821 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1378 bp · TkA02G557920|TK1151|cDNA

CGCTTACAAAAATAAATTGAAAAAAAAAAAAGAACAATGAACCCAGATTTCAGTTGGGAAAAGTTTAAAGTACGGAGATGAACGTGGTTGATTGAAGTTCACAAACGAAGCTGAAGGCCGGAGTTGTTCATCAGAACAACTTCTACTCGATCATCAAATCATTGAAATGGCTGCGTTAAATCTAAGCTGTTACCATCCTTTACATTCCCTTTCTCACTCACCATCACCACCACGGAATGTCTCCCCTGTTTCCATTCTAC...

CDS

Download CDS FASTA

894 bp · TkA02G557920|TK1151|CDS

ATGGCTGCGTTAAATCTAAGCTGTTACCATCCTTTACATTCCCTTTCTCACTCACCATCACCACCACGGAATGTCTCCCCTGTTTCCATTCTACGTGATCGTAATAAGCTTTATCCCTCGACAATCCCATTAACATTTCATAAACGGAAGCTTCACAATAGTCTATTGGTTCTAGCAACAACAATGCCTACTAGTGTGCAAGAGAATCTTCCGCCTGCTCTCGATTCTACTTCAGAACCACCTCCGGTCTTTGATGGAAC...

Protein

Download Protein FASTA

297 aa · TkA02G557920|TK1151|PROTEIN

MAALNLSCYHPLHSLSHSPSPPRNVSPVSILRDRNKLYPSTIPLTFHKRKLHNSLLVLATTMPTSVQENLPPALDSTSEPPPVFDGTTRLYISYTCPYAQRVWITRNCKGLQENIKLVPIDLKNRPDWYKEKVYPANKVPALEHNNEVKGESLDLIKYINDNFQGPSLYPDDPVKKEFGEELLSYTNKFYKSVTNSFKGDGVDEAAAAFDYIENALSKFNDGPFFLGHFSLVDIAYAPFIERFQPYLLDVKNYDVNIGRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G557920`
TK1151 ID	TkA02G557920
OH-1004 ID	LXL04_012495
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.500
Protein coverage (%)	TK1151 99.663 / OH-1004 96.530 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G557920

Location Chr02:144120472-144122821 (-)

Description Similar to GSTL2: Glutathione S-transferase L2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55040`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At5g02780`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At5g02790`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A1XBB7`	Protein IN2-1 homolog B.	No verified direct reference in this release
`Os03g0283100`	Protein IN2-1 homolog B.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009636 response to toxic substance Biological Process

GO:0010731 protein glutathionylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G55040

ath:AT5G02780

ath:AT5G02790

dosa:Os03g0283100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · TkA02G557920 · TK1151

Mitochondrion0.039

Rank 2 · TkA02G557920 · TK1151

Cytoplasm0.025

Rank 3 · TkA02G557920 · TK1151

Peroxisome0.016

Rank 4 · TkA02G557920 · TK1151

Nucleus0.014

Rank 5 · TkA02G557920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798GST_N89-159 aa

PF13417GST_N_390-166 aa

PF13409GST_N_295-161 aa

PF22441CLIC-like_N95-163 aa

PF14497GST_C_3175-192 aa

PF16865GST_C_5192-264 aa

PF13410GST_C_2202-267 aa

PF00043GST_C203-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G557920	`PF02798`	GST_N	89	159	0.00058	20.9
TkA02G557920	`PF13417`	GST_N_3	90	166	1.5e-21	77.2
TkA02G557920	`PF13409`	GST_N_2	95	161	4.6e-17	63.1
TkA02G557920	`PF22441`	CLIC-like_N	95	163	0.00017	22.4
TkA02G557920	`PF14497`	GST_C_3	175	192	0.16	12.9
TkA02G557920	`PF16865`	GST_C_5	192	264	4.5e-06	27.9
TkA02G557920	`PF13410`	GST_C_2	202	267	2e-11	44.5
TkA02G557920	`PF00043`	GST_C	203	271	0.00013	22.8
TkA02G557920	`PF14497`	GST_C_3	207	272	0.16	12.9
TkA02G557920	`PF02798`	GST_N	251	268	0.00058	20.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2W2`	Arabidopsis thaliana	sp\|Q9M2W2\|GSTL2_ARATH Glutathione S-transferase L2, chloroplastic	67.800%	Swiss-Prot	High
`Q6NLB0`	Arabidopsis thaliana	sp\|Q6NLB0\|GSTL1_ARATH Glutathione S-transferase L1	68.000%	Swiss-Prot	High
`Q9LZ06`	Arabidopsis thaliana	sp\|Q9LZ06\|GSTL3_ARATH Glutathione S-transferase L3	63.900%	Swiss-Prot	High
`A1XBB7`	Oryza sativa subsp. indica	sp\|A1XBB7\|IN21B_ORYSI Protein IN2-1 homolog B	64.300%	Swiss-Prot	High
`Q8H8U5`	Oryza sativa subsp. japonica	sp\|Q8H8U5\|IN21B_ORYSJ Protein IN2-1 homolog B	64.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card