RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G555820
Reference: TK1151 Chr: Chr02 Coordinates: 143465328-143470090 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3886 bp · TkA02G555820|TK1151|cDNA

AAAGGAAATGTGTCAAAATGAGCCCTTGAATGCCTCAAAACCTCGAGAATCCATGAGCCCTCAATAACACCCTGCTCAGCTTTAGAATCACGAGGACCAAACCCTACCCATGATCGCCAAAGTTGATAGAATTGGGGAAGGCTTCACCAACTGATCGGAAAAGCTACATACATTTTCCTGTTAAACCAGCATTGGACATACTAATGGACACATATGGTAACAATAATACTGGCATCATGGAATCAAATTTAACTCCAGAT...

CDS

Download CDS FASTA

3519 bp · TkA02G555820|TK1151|CDS

ATGGACACATATGGTAACAATAATACTGGCATCATGGAATCAAATTTAACTCCAGATCTAAGTGAAGAATTTCTAGAAGACTTCTGTAAAAAAGCATCAAAATCCTTTTTCAAGCAGCATGGTCTCATAAGCCACCAGATCAACTCTTACAATGAATTCCTCAAAAACGGAATTCAAACCCTCTTTGATTCCTTAGGTGAGATCAAAGTCGAGCCAGGATTCGACCCATCTGGAATTGAAACCGTACGAAGATACGCCTC...

Protein

Download Protein FASTA

1172 aa · TkA02G555820|TK1151|PROTEIN

MDTYGNNNTGIMESNLTPDLSEEFLEDFCKKASKSFFKQHGLISHQINSYNEFLKNGIQTLFDSLGEIKVEPGFDPSGIETVRRYASVKIGKVNLDMPMFWAGDTFSTENGTDYLKLLPKHARLQNITYSSRMTVHIQFQVYSEELVKIDTLEAGKELIEKKVIFDDSREIAIGRLPVMVKSDLCWMNETKKVDCEFDHGGYFLIKGAEKTFIAQEKTCLKRLWLVNNPNWTCKYRSMSGKERVYVKLVDTHIRGGGKVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G555820
TK1151 IDTkA02G555820
OH-1004 IDLXL04_039669
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)65.400
Protein coverage (%)TK1151 99.147 / OH-1004 97.617
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G555820
LocationChr02:143465328-143470090 (+)
DescriptionSimilar to NRPD2: DNA-directed RNA polymerases IV and V subunit 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g23780 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
Atypical RNA polymerase subunits required for RNA-directed DNA methylation.2005 · DOI: 10.1038/ng1580
Reinforcement of silencing at transposons and highly repeated sequences requires the concerted action of two distinct RNA polymerases IV in Arabidopsis.2005 · DOI: 10.1101/gad.348405
Transcriptional silencing induced by Arabidopsis T-DNA mutants is associated with 35S promoter siRNAs and requires genes involved in siRNA-mediated chromatin silencing.2010 · DOI: 10.1111/j.1365-313x.2010.04358.x
At3g18090 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. No verified direct reference in this release
At4g21710 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_039669 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006354 DNA-templated transcription elongation Biological Process
GO:0006366 transcription by RNA polymerase II Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process
GO:0030422 siRNA processing Biological Process
GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process
GO:0031507 heterochromatin formation Biological Process
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing Biological Process
GO:0035196 miRNA processing Biological Process
GO:0050776 regulation of immune response Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process
GO:0141007 transposable element silencing by siRNA-mediated heterochromatin formation Biological Process
KEGG gene cross-reference
ath:AT3G18090
ath:AT3G23780
ath:AT4G21710
ddi:DDB_G0288257
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945
Rank 1 · TkA02G555820 · TK1151
Cytoplasm0.074
Rank 2 · TkA02G555820 · TK1151
Cell membrane0.022
Rank 3 · TkA02G555820 · TK1151
Mitochondrion0.015
Rank 4 · TkA02G555820 · TK1151
Endoplasmic reticulum0.011
Rank 5 · TkA02G555820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04563RNA_pol_Rpb2_141-421 aa
PF04561RNA_pol_Rpb2_2265-391 aa
PF17803Cadherin_4296-343 aa
PF04566RNA_pol_Rpb2_4456-479 aa
PF04565RNA_pol_Rpb2_3468-526 aa
PF00562RNA_pol_Rpb2_6513-580 aa
PF04566RNA_pol_Rpb2_4568-629 aa
PF04567RNA_pol_Rpb2_5644-687 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G555820PF04563RNA_pol_Rpb2_1414215.3e-31108.5
TkA02G555820PF04561RNA_pol_Rpb2_22653916.7e-1142.9
TkA02G555820PF17803Cadherin_42963430.2612.4
TkA02G555820PF04566RNA_pol_Rpb2_44564795.4e-2381.6
TkA02G555820PF04565RNA_pol_Rpb2_34685267.2e-1555.6
TkA02G555820PF00562RNA_pol_Rpb2_65135803.8e-105352.8
TkA02G555820PF04566RNA_pol_Rpb2_45686295.4e-2381.6
TkA02G555820PF04567RNA_pol_Rpb2_56446874.7e-0628.1
TkA02G555820PF04560RNA_pol_Rpb2_76596771e-2487.5
TkA02G555820PF00562RNA_pol_Rpb2_669610693.8e-105352.8
TkA02G555820PF04560RNA_pol_Rpb2_7107111681e-2487.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LK40Arabidopsis thalianasp|Q9LK40|NRPD2_ARATH DNA-directed RNA polymerases IV and V subunit 260.400%Swiss-ProtHigh
Q9LV32Arabidopsis thalianasp|Q9LV32|RPD2B_ARATH DNA-directed RNA polymerase D subunit 2b58.200%Swiss-ProtHigh
P38420Arabidopsis thalianasp|P38420|NRPB2_ARATH DNA-directed RNA polymerase II subunit 234.100%Swiss-ProtMedium

JBrowse

View in Genome Browser