TkA02G555780 | RubberDandelionOmics

Gene overview

TkA02G555780

Reference: TK1151 Chr: Chr02 Coordinates: 143446660-143447524 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA02G555780|TK1151|cDNA

ATGCAAGCCTTCTACGGGTTCCTAAAGCAACACGCTGCGATACCTTTCCAGCTCCAGAACCCTGAGTCGACTCAGAGACCCGAAACAGCCTACGCCATATCACCTGCACCTACACCTGATCCACACCGGTGGTTTGCACCTGGTTCGGGTCCTGCACCAGGACCACCACCAGTTTCTCCGGCACCAGAGCTGCCACCACCAGTCCTACCAGCACCTCCGACCGGTGGCGGCGGCGGCGGTGGTGGTGTGCTGCCAAATGA...

CDS

Download CDS FASTA

429 bp · TkA02G555780|TK1151|CDS

ATGCAAGCCTTCTACGGGTTCCTAAAGCAACACGCTGCGATACCTTTCCAGCTCCAGAACCCTGAGTCGACTCAGAGACCCGAAACAGCCTACGCCATATCACCTGCACCTACACCTGATCCACACCGGTGGTTTGCACCTGGTTCGGGTCCTGCACCAGGACCACCACCAGTTTCTCCGGCACCAGAGCTGCCACCACCAGTCCTACCAGCACCTCCGACCGGTGGCGGCGGCGGCGGTGGTGGTGTGCTGCCAAATGA...

Protein

Download Protein FASTA

142 aa · TkA02G555780|TK1151|PROTEIN

MQAFYGFLKQHAAIPFQLQNPESTQRPETAYAISPAPTPDPHRWFAPGSGPAPGPPPVSPAPELPPPVLPAPPTGGGGGGGGVLPNENGGGSSGLSGGQKAGITIGVLAGAGLIGFATVVYMKRRSNVRRARFGASARSSQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G555780`
TK1151 ID	TkA02G555780
OH-1004 ID	LXL04_012547
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.900
Protein coverage (%)	TK1151 100.000 / OH-1004 27.290 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G555780`
Location	Chr02:143446660-143447524 (-)
Description	Similar to PDIL1-4: Protein disulfide isomerase-like 1-4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012547` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005788 endoplasmic reticulum lumen Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0099503 secretory vesicle Cellular Component GO:0003756 protein disulfide isomerase activity Molecular Function
KEGG gene cross-reference	ath:AT3G54960 ath:AT5G60640 dosa:Os02g0100100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.405

Rank 1 · TkA02G555780 · TK1151

Extracellular0.300

Rank 2 · TkA02G555780 · TK1151

Cytoplasm0.155

Rank 3 · TkA02G555780 · TK1151

Endoplasmic reticulum0.119

Rank 4 · TkA02G555780 · TK1151

Nucleus0.074

Rank 5 · TkA02G555780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03302VSP71-124 aa

PF05808Podoplanin93-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G555780	`PF03302`	VSP	71	124	0.18	11.3
TkA02G555780	`PF05808`	Podoplanin	93	126	0.089	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card