TkA02G555610 | RubberDandelionOmics

Gene overview

TkA02G555610

Reference: TK1151 Chr: Chr02 Coordinates: 143397949-143401585 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1711 bp · TkA02G555610|TK1151|cDNA

CTTTCAGTCAAAGAGGCATATCACAACCTACTAATTTTATGATAAATAAATTTGAAAATCAAAAGATTGCAAAGTTAGGTGGCCACCAAACACGGCCACACAGTCCGCCCACCAACCCCTCTCTATACCCAACTCATATTTAGGCGTAGATCGTGTACATAGTTTCTTCGCAAGAAATAAATGGCGTCTTCTCTGTTAACCAAACCCTTCGTTGGAGCTTCATCCTCTGGTGAACCCTCACGCTTTGCCTCTCTACGTCA...

CDS

Download CDS FASTA

717 bp · TkA02G555610|TK1151|CDS

ATGATAAAAGTACCCAACACAGATCAAAGGGGAAAAGACTACAGTGAAATGTCAATGGCTTATAGGCCTTCTCATGCTGATGCAACTTATGACTTCAAATATGGTGTACGATCAGTAGAGGGTGGTGGTCGATCATCAGCTAGGGAGACAATTGGCAGAGTTGCTTCTGGAGCTCTTGCAAAAAAGATTCTTAAAGCATATTCAGGAACCGAGATTCTTGCTTATGTGTCTCAAGCCCATAAAGTTGTACTTCCAGAGGG...

Protein

Download Protein FASTA

238 aa · TkA02G555610|TK1151|PROTEIN

MIKVPNTDQRGKDYSEMSMAYRPSHADATYDFKYGVRSVEGGGRSSARETIGRVASGALAKKILKAYSGTEILAYVSQAHKVVLPEGLVDHETLTLEQVESNIVRCPNPEYAEKMIAAIDAVRVRGDSVGGVVTCIVRNAPRGLGSAVFDKLEAELAKAAMSLPATKGFEFGSGFGGTFLTGSEHNDEFYKDESGRIRTRTNRSGGIQGGISNGEIINMRIGFNQHPPFKKAKHCDKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G555610`
TK1151 ID	TkA02G555610
OH-1004 ID	LXL04_012545
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 93.697 / OH-1004 50.567 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G555610

Location Chr02:143397949-143401585 (+)

Description Similar to CS1: Chorismate synthase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48850`	Catalyzes the last common step of the biosynthesis of aromatic amino acids, produced via the shikimic acid pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012545 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004107 chorismate synthase activity Molecular Function

GO:0010181 FMN binding Molecular Function

KEGG gene cross-reference

ath:AT1G48850

cyp:PCC8801_1637

sly:544151

sly:544154

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.657

Rank 1 · TkA02G555610 · TK1151

Nucleus0.402

Rank 2 · TkA02G555610 · TK1151

Mitochondrion0.098

Rank 3 · TkA02G555610 · TK1151

Cell membrane0.036

Rank 4 · TkA02G555610 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA02G555610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01264Chorismate_synt2-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G555610	`PF01264`	Chorismate_synt	2	231	7.6e-75	252.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57720`	Arabidopsis thaliana	sp\|P57720\|AROC_ARATH Chorismate synthase, chloroplastic	87.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card