TkA02G555220 | RubberDandelionOmics

Gene overview

TkA02G555220

Reference: TK1151 Chr: Chr02 Coordinates: 143274684-143275076 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA02G555220|TK1151|cDNA

ATGATGTTTTCACTTTTTGGGGAGTTTGCCGCTGGCAAACTTTTTATGCGGAGTGGTAGAAATCGAAAAAACCAGCGGCTTGTGCATGCCGATGGAGTTTGCCGCTGGCAAACTTTGCCTCTGCACCCGGCCATACCTTCCACTTCGCCAGCGGTAAACTCGGTCAGGTGGCATACCGCTGGCTTTTTCCCGGCCATACCGTCAGTCTTAGAGAGTGTATGGAGAATTTCAAAACTATGGGTCAAATTCAGCATCACTAT...

CDS

Download CDS FASTA

312 bp · TkA02G555220|TK1151|CDS

ATGATGTTTTCACTTTTTGGGGAGTTTGCCGCTGGCAAACTTTTTATGCGGAGTGGTAGAAATCGAAAAAACCAGCGGCTTGTGCATGCCGATGGAGTTTGCCGCTGGCAAACTTTGCCTCTGCACCCGGCCATACCTTCCACTTCGCCAGCGGTAAACTCGGTCAGGTGGCATACCGCTGGCTTTTTCCCGGCCATACCGTCAGTCTTAGAGAGTGTATGGAGAATTTCAAAACTATGGGTCAAATTCAGCATCACTAT...

Protein

Download Protein FASTA

103 aa · TkA02G555220|TK1151|PROTEIN

MMFSLFGEFAAGKLFMRSGRNRKNQRLVHADGVCRWQTLPLHPAIPSTSPAVNSVRWHTAGFFPAIPSVLESVWRISKLWVKFSITIGTNGFQRSIISFFFAP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G555220`
TK1151 ID	TkA02G555220
OH-1004 ID	LXL04_019152
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.900
Protein coverage (%)	TK1151 36.893 / OH-1004 8.426 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G555220`
Location	Chr02:143274684-143275076 (+)
Description	Similar to DNAJB13: DnaJ homolog subfamily B member 13
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019152` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0003341 cilium movement Biological Process GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process GO:0006457 protein folding Biological Process GO:0006986 response to unfolded protein Biological Process GO:0007618 mating Biological Process GO:0009408 response to heat Biological Process GO:0030317 flagellated sperm motility Biological Process GO:1904158 axonemal central apparatus assembly Biological Process GO:0001534 radial spoke Cellular Component GO:0005576 extracellular region Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	hsa:11080 hsa:374407 mmu:67035 mmu:69387 pon:100174554 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401

Rank 1 · TkA02G555220 · TK1151

Nucleus0.271

Rank 2 · TkA02G555220 · TK1151

Mitochondrion0.262

Rank 3 · TkA02G555220 · TK1151

Cell membrane0.083

Rank 4 · TkA02G555220 · TK1151

Extracellular0.070

Rank 5 · TkA02G555220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03387Herpes_UL4651-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G555220	`PF03387`	Herpes_UL46	51	98	0.078	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card