TkA02G554440 | RubberDandelionOmics

Gene overview

TkA02G554440

Reference: TK1151 Chr: Chr02 Coordinates: 143052802-143056619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2853 bp · TkA02G554440|TK1151|cDNA

GGGAAATCAGATTTGATGTGCTAAATATATATATATATATATATCCCTCTCTAAATAACCATTGATCAATAAACAATTCCAAAACAAGAACACACCCATGAATGACATGCTCTTTAGCCTCCTTATCCTTCTTCAATCGCTCCAAATAATTTCTGCTGCAATGGACACCATACCTGCAAATCAGTCCATAAGAGAAGGTGACACCATCATCTCTAGCGGTGAAATATTTGAACTGGGTTTTTTTAGCCCTGGCAACTCAA...

CDS

Download CDS FASTA

2490 bp · TkA02G554440|TK1151|CDS

ATGAATGACATGCTCTTTAGCCTCCTTATCCTTCTTCAATCGCTCCAAATAATTTCTGCTGCAATGGACACCATACCTGCAAATCAGTCCATAAGAGAAGGTGACACCATCATCTCTAGCGGTGAAATATTTGAACTGGGTTTTTTTAGCCCTGGCAACTCAAAGAACCGTTATTTGGGGATATGGTATTATAACCTATCTCCTCAAACGGTTGTTTGGGTTGCTAACAGAGATACACCACTTACAAATACATCAGAAGG...

Protein

Download Protein FASTA

829 aa · TkA02G554440|TK1151|PROTEIN

MNDMLFSLLILLQSLQIISAAMDTIPANQSIREGDTIISSGEIFELGFFSPGNSKNRYLGIWYYNLSPQTVVWVANRDTPLTNTSEGLFTVSSDGILLLLNGAETVWSSNSSVSVKTITPVAQLLDTGNLIVRNESDVNHLSLIWESFDYPGDTILPGMKFGSDFVSGKESRLTSWKSLDDPSEGQYVDWLDTKGYPQGFQRRGSIIQHRFGAWNGLRFSGFPSVTQNSIYTFEFVFNKKEAYVIAELKNRSFLSRVYIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G554440`
TK1151 ID	TkA02G554440
OH-1004 ID	LXL04_012531
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.400
Protein coverage (%)	TK1151 83.595 / OH-1004 45.024 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G554440

Location Chr02:143052802-143056619 (-)

Description Similar to At4g27290: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At4g27300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G21380

ath:AT4G27290

ath:AT4G27300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.857

Rank 1 · TkA02G554440 · TK1151

Endoplasmic reticulum0.081

Rank 2 · TkA02G554440 · TK1151

Cytoplasm0.070

Rank 3 · TkA02G554440 · TK1151

Nucleus0.037

Rank 4 · TkA02G554440 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA02G554440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17785PUA_353-74 aa

PF01453B_lectin70-177 aa

PF17785PUA_3180-199 aa

PF00954S_locus_glycop210-316 aa

PF17785PUA_3221-262 aa

PF06247Plasmod_Pvs28288-317 aa

PF08276PAN_2339-405 aa

PF00954S_locus_glycop352-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G554440	`PF17785`	PUA_3	53	74	0.15	12.5
TkA02G554440	`PF01453`	B_lectin	70	177	1.2e-32	113.2
TkA02G554440	`PF17785`	PUA_3	180	199	0.15	12.5
TkA02G554440	`PF00954`	S_locus_glycop	210	316	4.4e-25	89.1
TkA02G554440	`PF17785`	PUA_3	221	262	0.15	12.5
TkA02G554440	`PF06247`	Plasmod_Pvs28	288	317	0.046	14.5
TkA02G554440	`PF08276`	PAN_2	339	405	3.5e-20	72.6
TkA02G554440	`PF00954`	S_locus_glycop	352	381	4.4e-25	89.1
TkA02G554440	`PF00069`	Pkinase	516	718	9.9e-46	157.0
TkA02G554440	`PF07714`	PK_Tyr_Ser-Thr	517	784	2.3e-49	168.8
TkA02G554440	`PF03109`	ABC1	523	564	0.00029	20.8
TkA02G554440	`PF03109`	ABC1	583	670	0.00029	20.8
TkA02G554440	`PF11883`	DUF3403	789	829	2e-09	38.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81832`	Arabidopsis thaliana	sp\|O81832\|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	50.000%	Swiss-Prot	High
`O81833`	Arabidopsis thaliana	sp\|O81833\|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	45.400%	Swiss-Prot	Medium
`O81905`	Arabidopsis thaliana	sp\|O81905\|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8	44.600%	Swiss-Prot	Medium
`Q39086`	Arabidopsis thaliana	sp\|Q39086\|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7	44.100%	Swiss-Prot	Medium
`Q9S972`	Arabidopsis thaliana	sp\|Q9S972\|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6	44.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card