TkA02G553580 | RubberDandelionOmics

Gene overview

TkA02G553580

Reference: TK1151 Chr: Chr02 Coordinates: 142847375-142848731 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA02G553580|TK1151|cDNA

CAGGCTCATTTGCTGCGACTTGCTTGTGCTCCAAAAGGTCCACTTGCTGATGCCTTAACTGATGTAACATCAGAGCTGGTTAACTTAGGGATTGTTTCAGACCGTGTGGCAGATTTAGCAACAGAATCGTCATCACATTTTGACAATCAGGCTTTTGGACATCGTATGGTGGCATCAAAGGTATCTCATTTTTGGAAAACTGTTTCTGATTCCAAAGGGCAGCATACCTCACCTACATTAAACTCTCGGTATCTGAATGA...

CDS

Download CDS FASTA

477 bp · TkA02G553580|TK1151|CDS

CAGGCTCATTTGCTGCGACTTGCTTGTGCTCCAAAAGGTCCACTTGCTGATGCCTTAACTGATGTAACATCAGAGCTGGTTAACTTAGGGATTGTTTCAGACCGTGTGGCAGATTTAGCAACAGAATCGTCATCACATTTTGACAATCAGGCTTTTGGACATCGTATGGTGGCATCAAAGGTATCTCATTTTTGGAAAACTGTTTCTGATTCCAAAGGGCAGCATACCTCACCTACATTAAACTCTCGGTATCTGAATGA...

Protein

Download Protein FASTA

158 aa · TkA02G553580|TK1151|PROTEIN

QAHLLRLACAPKGPLADALTDVTSELVNLGIVSDRVADLATESSSHFDNQAFGHRMVASKVSHFWKTVSDSKGQHTSPTLNSRYLNDFEELQPLDIQVLREVATLSHLQHQHVVRYYHAWFETGVSGSYNDATWNGSRTAASSSFSFIDQTSTDVVGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G553580`
TK1151 ID	TkA02G553580
OH-1004 ID	LXL04_023165
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.300
Protein coverage (%)	TK1151 99.367 / OH-1004 16.020 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G553580

Location Chr02:142847375-142848731 (+)

Description Similar to GCN2: eIF-2-alpha kinase GCN2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59410`	Metabolic-stress sensing protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 eIF-2-alpha in response to low amino acid availability.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023165 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0006412 translation Biological Process

GO:0006446 regulation of translational initiation Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009893 positive regulation of metabolic process Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0018105 peptidyl-serine phosphorylation Biological Process

GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process

GO:0031589 cell-substrate adhesion Biological Process

GO:0032057 negative regulation of translational initiation in response to stress Biological Process

KEGG gene cross-reference

ath:AT3G59410

ddi:DDB_G0276829

sce:YDR283C

spo:2540500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA02G553580 · TK1151

Nucleus0.337

Rank 2 · TkA02G553580 · TK1151

Cell membrane0.133

Rank 3 · TkA02G553580 · TK1151

Golgi apparatus0.123

Rank 4 · TkA02G553580 · TK1151

Mitochondrion0.088

Rank 5 · TkA02G553580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04494TFIID_NTD274-118 aa

PF00069Pkinase95-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G553580	`PF04494`	TFIID_NTD2	74	118	0.18	12.8
TkA02G553580	`PF00069`	Pkinase	95	121	0.097	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX30`	Arabidopsis thaliana	sp\|Q9LX30\|GCN2_ARATH eIF-2-alpha kinase GCN2	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card