RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G551280
Reference: TK1151 Chr: Chr02 Coordinates: 142258631-142262180 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1324 bp · TkA02G551280|TK1151|cDNA

CTGGTTTAAGAGCGCCTAACCAAATGTAAAAGGACGTAGGCGGTAAGAGTTTACTAGTGAAGGGTGTAAATGTCAATAGCAAACTACCCATATGCCCGATTGCATCATCAATTCCTTCTGCTAGGGTTTCCACTTCCTAAAACCTACACACACGTTATTCTGGAAAGAAAGTCGATTCATCAGAGGTGAAAGGCAAATTTAGGCATATTGATTGTTAAACTGGATGGCTGGAAAAGATTCGGACTACCGTATATTTGTAG...

CDS

Download CDS FASTA

882 bp · TkA02G551280|TK1151|CDS

ATGGCTGGAAAAGATTCGGACTACCGTATATTTGTAGGAGGGCTCTCATGGGACGTTACTGATCGTCAGCTTGAAGACTCCTTTAGTCGTTTCGGAAAAATTATCGACTCTCAGATAATGCTTGAAAGAGACACGGGGCGTCCACGTGGATTCGGTTTCATAACATTTTCAGACCGTAGAGGCATGGAAGACGCAATCAGGGAAATGCACGGAAGTGATCTCGGTGACCGTGTCATCTCCGTCAACAAAGCCCAGCCTAA...

Protein

Download Protein FASTA

293 aa · TkA02G551280|TK1151|PROTEIN

MAGKDSDYRIFVGGLSWDVTDRQLEDSFSRFGKIIDSQIMLERDTGRPRGFGFITFSDRRGMEDAIREMHGSDLGDRVISVNKAQPKMGGDEADHGYPSGGRGGGGGGYGGDTRSMGQDECFKCGRSGHWARDCPSGGGGGGGGGQFSSRPRFGGGGRGDRYADRERYVEDRYDGGRFGDRDRYDSRDSKYVGSRSRYSNERYVPSSGGDRFGGDRYGVPERYPPLAAPPPPPPQSGYGREREYDREVGPRRSSDRYGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G551280
TK1151 IDTkA02G551280
OH-1004 IDLXL04_012590
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)86.500
Protein coverage (%)TK1151 93.857 / OH-1004 84.011
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G551280
LocationChr02:142258631-142262180 (-)
DescriptionSimilar to RZ1C: Glycine-rich RNA-binding protein RZ1C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g04280 Binds RNA and DNA sequences non-specifically. No verified direct reference in this release
At1g60650 Binds RNA and DNA sequences non-specifically. No verified direct reference in this release
At3g26420 Binds RNA and DNA sequences with a preference to single-stranded nucleic acids. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012590 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0016070 RNA metabolic process Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0048026 positive regulation of mRNA splicing, via spliceosome Biological Process
GO:0005634 nucleus Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016607 nuclear speck Cellular Component
GO:0000166 nucleotide binding Molecular Function
KEGG gene cross-reference
ath:AT1G60650
ath:AT3G26420
ath:AT5G04280
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962
Rank 1 · TkA02G551280 · TK1151
Cytoplasm0.202
Rank 2 · TkA02G551280 · TK1151
Cell membrane0.018
Rank 3 · TkA02G551280 · TK1151
Endoplasmic reticulum0.012
Rank 4 · TkA02G551280 · TK1151
Extracellular0.011
Rank 5 · TkA02G551280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16367RRM_79-69 aa
PF00076RRM_110-79 aa
PF28441RRM_1113-84 aa
PF30379SLU7_N114-134 aa
PF14787zf-CCHC_5119-136 aa
PF13917zf-CCHC_3119-135 aa
PF00098zf-CCHC120-136 aa
PF13696zf-CCHC_2121-135 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G551280PF16367RRM_79696.4e-0730.0
TkA02G551280PF00076RRM_110798.4e-2174.3
TkA02G551280PF28441RRM_1113840.01916.0
TkA02G551280PF30379SLU7_N1141340.02514.8
TkA02G551280PF14787zf-CCHC_51191360.0005120.4
TkA02G551280PF13917zf-CCHC_31191350.09913.2
TkA02G551280PF00098zf-CCHC1201364.8e-0833.5
TkA02G551280PF13696zf-CCHC_21211350.002118.5
TkA02G551280PF14392zf-CCHC_41211350.3511.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8RWN5Arabidopsis thalianasp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C48.700%Swiss-ProtMedium
O22703Arabidopsis thalianasp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B45.200%Swiss-ProtMedium
Q9LIN3Arabidopsis thalianasp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A42.900%Swiss-ProtLow

JBrowse

View in Genome Browser