RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G550860
Reference: TK1151 Chr: Chr02 Coordinates: 142131941-142141208 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2563 bp · TkA02G550860|TK1151|cDNA

AAGCAGAAATGACAGTGAACATAACAGCAATCAAAACAGCATCAGACGGTGTTTGGCAAGGTGATAACCCCTTGGACTATGCATTTCCATTGTTGATTGTCCAAACTACCCTTGTCCTCGCGGTTAGCCGCTCATTAGCCTTCCTCCTCAAGCCTCTTCGCCAGCCCAAAGTCATCGCCGAGATCGTCGGTGGAATACTTTTGGGACCATCGGCGTTGGGCCGGAACCAAGAGTACATGCACCGGATATTTCCCAAATGG...

CDS

Download CDS FASTA

2454 bp · TkA02G550860|TK1151|CDS

ATGACAGTGAACATAACAGCAATCAAAACAGCATCAGACGGTGTTTGGCAAGGTGATAACCCCTTGGACTATGCATTTCCATTGTTGATTGTCCAAACTACCCTTGTCCTCGCGGTTAGCCGCTCATTAGCCTTCCTCCTCAAGCCTCTTCGCCAGCCCAAAGTCATCGCCGAGATCGTCGGTGGAATACTTTTGGGACCATCGGCGTTGGGCCGGAACCAAGAGTACATGCACCGGATATTTCCCAAATGGAGTTCACC...

Protein

Download Protein FASTA

817 aa · TkA02G550860|TK1151|PROTEIN

MTVNITAIKTASDGVWQGDNPLDYAFPLLIVQTTLVLAVSRSLAFLLKPLRQPKVIAEIVGGILLGPSALGRNQEYMHRIFPKWSSPILESVASIGLLFFLFLVGLELDLSSIRRSGKRAFAIAAAGISLPFIFGIGVAFVLRKTIDGADKVGYAQYFVFMGVALSITAFPVLARILAELKLLTTRVGETAMAAAAFNDIVAWILLALAVALAGNGEEGGPHKSPIVSVWVLLSGVAFVIFMMTVIRPAMNWVARRCSPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G550860
TK1151 IDTkA02G550860
OH-1004 IDLXL04_032748
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)59.100
Protein coverage (%)TK1151 97.919 / OH-1004 93.103
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G550860
LocationChr02:142131941-142141208 (-)
DescriptionSimilar to CHX20: Cation/H(+) antiporter 20
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g53720 May act as a K⁺/H⁺ antiporter that maintains guard-cell K⁺ homeostasis and regulates pH.
Participation of endomembrane cation/H+ exchanger AtCHX20 in osmoregulation of guard cells.2007 · DOI: 10.1104/pp.106.092155
At3g17630 May operate as a cation/H(+) antiporter. No verified direct reference in this release
At5g41610 May operate as a cation/H(+) antiporter. No verified direct reference in this release
At1g64170 May operate as a cation/H(+) antiporter. No verified direct reference in this release
At4g23700 Operates as a K(+)/H(+) antiporter that controls K(+) acquisition and homeostasis.
Characterization of AtCHX17, a member of the cation/H+ exchangers, CHX family, from Arabidopsis thaliana suggests a role in K+ homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02177.x
Arabidopsis thaliana CHX17 gene complements the kha1 deletion phenotypes in Saccharomyces cerevisiae.2006 · DOI: 10.1002/yea.1424

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006623 protein targeting to vacuole Biological Process
GO:0006813 potassium ion transport Biological Process
GO:0006885 regulation of pH Biological Process
GO:0030007 intracellular potassium ion homeostasis Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:1902600 proton transmembrane transport Biological Process
GO:0005634 nucleus Cellular Component
GO:0005770 late endosome Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0012505 endomembrane system Cellular Component
GO:0016020 membrane Cellular Component
KEGG gene cross-reference
ath:AT1G64170
ath:AT3G17630
ath:AT3G53720
ath:AT4G23700
ath:AT5G41610
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.831
Rank 1 · TkA02G550860 · TK1151
Endoplasmic reticulum0.090
Rank 2 · TkA02G550860 · TK1151
Cytoplasm0.063
Rank 3 · TkA02G550860 · TK1151
Lysosome / Vacuole0.052
Rank 4 · TkA02G550860 · TK1151
Golgi apparatus0.032
Rank 5 · TkA02G550860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999Na_H_Exchanger43-425 aa
PF15145DUF4577213-266 aa
PF04186FxsA235-291 aa
PF28153VraH269-288 aa
PF04186FxsA345-366 aa
PF23259CHX17_C375-401 aa
PF28153VraH399-425 aa
PF23259CHX17_C471-551 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G550860PF00999Na_H_Exchanger434258.3e-64216.5
TkA02G550860PF15145DUF45772132660.212.4
TkA02G550860PF04186FxsA2352910.04114.7
TkA02G550860PF28153VraH2692885.77.6
TkA02G550860PF04186FxsA3453660.04114.7
TkA02G550860PF23259CHX17_C3754016.1e-2588.7
TkA02G550860PF28153VraH3994255.77.6
TkA02G550860PF23259CHX17_C4715516.1e-2588.7
TkA02G550860PF29729Kebab_C4785260.02315.2
TkA02G550860PF23256CHX17_2nd4836141.8e-33116.0
TkA02G550860PF00582Usp5516090.001519.8
TkA02G550860PF23259CHX17_C6317946.1e-2588.7
TkA02G550860PF00582Usp6997520.001519.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M353Arabidopsis thalianasp|Q9M353|CHX20_ARATH Cation/H(+) antiporter 2067.000%Swiss-ProtHigh
Q9LUN4Arabidopsis thalianasp|Q9LUN4|CHX19_ARATH Cation/H(+) antiporter 1951.600%Swiss-ProtHigh
Q9FFR9Arabidopsis thalianasp|Q9FFR9|CHX18_ARATH Cation/H(+) antiporter 1851.000%Swiss-ProtHigh
Q1HDT3Arabidopsis thalianasp|Q1HDT3|CHX16_ARATH Cation/H(+) antiporter 1648.200%Swiss-ProtMedium
Q9SUQ7Arabidopsis thalianasp|Q9SUQ7|CHX17_ARATH Cation/H(+) antiporter 1748.100%Swiss-ProtMedium

JBrowse

View in Genome Browser